![]()
|
[Frontiers in Bioscience 4, d212-215, March 1, 1999]
|
|
|---|---|---|
![]() ![]() ![]()
|
COMPARISON OF ZP3 PROTEIN SEQUENCES AMONG VERTEBRATE SPECIES: TO OBTAIN A CONSENSUS SEQUENCE FOR IMMUNOCONTRACEPTION Xiaolong Zhu and Rajesh K. Naz Division of Research, Department of Obstetrics and Gynecology, Medical College of Ohio, Health Education Building, Room 211, 3055 Arlington Avenue, Toledo, OH 43614-5806, USA TABLE OF CONTENTS
1. ABSTRACT The deduced ZP3 amino acid (aa) sequences of 13 vertebrate species namely mouse, hamster, rabbit, pig, porcine, cow, dog, cat, human, bonnet, marmoset, carp, and frog were compared using the PILEUP and PRETTY alignment programs (GCG, Wisconsin, USA). The published aa sequences obtained from 13 vertebrate species indicated the overall evolutionarily conservation in the N-terminus, central region, and C-terminus of the ZP3 polypeptide. More variations of ZP3 polypeptide sequences were seen in the alignments of carp and frog from the 11 mammalian species making the leader sequence more prominent. The canonical furin proteolytic processing signal at the C-terminus was found in all the ZP3 polypeptide sequences except of carp and frog. In the central region, the ZP3 deduced aa sequences of all the 13 vertebrate species aligned well, and six relatively conserved sequences were found. There are 11 conserved cysteine residues in the central region across all species including carp and frog, indicating that these residues have longer evolutionary history. The ZP3 aa sequence similarities were examined using the GAP program (GCG). The highest aa similarities are observed between the members of the same order within the class mammalia, and also (95.4%) between pig (ungulata) and rabbit (lagomorpha). The deduced ZP3 aa sequences per se may not be enough to build a phylogenetic tree. 2. INTRODUCTION The zona pellucida (ZP) forms an extracellular matrix around the developing oocyte and the preimplantation embryo (1). ZP is involved in several functions during fertilization, including mediation of species-specific binding of sperm to egg, induction of acrosome reaction of the bound sperm, and prevention of polyspermy. ZP also serves to protect the embryo prior to implantation in the uterine wall.
Studies in the mouse have suggested that ZP is composed of three sulfated glycoproteins, referred to as ZP1, ZP2, and ZP3, respectively (2, 3) and specific functions have been ascribed to each. ZP3 induces the sperm acrosome reaction and mediates the initial binding of sperm to the egg via O-linked oligosaccharide side chains. ZP2 acts as a secondary sperm receptor, and along with ZP3, is biochemically modified after fertilization to provide a block to polyspermy. An a -linked oligosaccharide of the ZP3 protein has been shown to be essential for sperm binding (4). The O-linked oligosaccharide on one or more of the serine residues of murine ZP3 (from position 331 to 335) are critical for sperm receptor activity (5). ZP2 and ZP3 exist as dimers in long filaments that appear to be cross-linked by ZP1 (6). The importance of ZP in the fertilization process has long been recognized, and therefore it has been the focus of extensive research for more than three decades (7). During the last 10 years, ZP3 cDNAs of several species have been cloned and sequenced, that include mouse (8, 9), hamster (10), rabbit (11), pig (12), cow, dog, cat, and porcine (13), human (14), bonnet (15), marmoset monkey (16), carp (17), and frog (18). The human recombinant ZP3 protein has been expressed in Chinese hamster ovary (CHO) cells and the glycosylated recombinant protein induces sperm acrosome reaction (19). Because active immunization with the native and recombinant ZP proteins induces infertility in primates (20, 21), attempts have been made to utilize ZP3 as an immunogen for contraceptive vaccine development. However, immunization with whole ZP also leads to transient or complete loss of ovarian function (22, 23) and in primates, a gradual loss of the primordial oocyte pool results in a state akin to premature menopause (24). Since the cell-mediated immunity (CMI) is primarily responsible for oophoritis, it is thought that by eliminating T-cell epitopes of ZP3 in vaccine formulation, one might be able to avoid ovarian failure and still able to retain the antibody–mediated reversible inhibition of fertility. During last five years, the research has focussed on obtaining minimal murine B-cell epitope sequence(s) of ZP3 that can produce specific antibody response (25, 26). In these studies, typically a T-cell epitope from a non-ZP/ovarian source such as from Plasmodium falciparum/tetanus toxoid/diphtheria toxoid was conjugated to ZP3-derived B-cell epitope (synthetic peptide) to produce target-specific antibodies and an irrelevant T-cell response. The aim of the present study was to search for a consensus sequence(s) among the ZP3 sequences of 13 vertebrate species (mouse, hamster, rabbbit, pig, porcine, cow, dog, cat, human, bonnet, marmoset, carp and frog) that could be used for the development of a contraceptive vaccine applicable to various species of animals. 3. MATERIALS AND METHODS The deduced aa sequences were obtained from the published sequences of ZP3 cDNAs of 13 vertebrate species (discussed above) and typed into computer manually . The PILEUP and PRETTY programs (GCG, Winsconsin, USA) were employed to generate a consensus sequence. The aa sequence similarities were calculated using the GAP program (GCG). 4. RESULTS 4.1. Alignment of ZP3 deduced amino acid sequences The deduced amino acid sequences of ZP3 is shown in figure 1. ![]() Figure 1. Comparison of ZP3 deduced amino acid sequences of 13 vertebrate species. Sequences are shown in the single letter abbreviation format, and are numbered starting from the N-terminus. The consensus sequence is shown above the individual sequences. Consensus positions are represented by an asterisk and the missing positions by dash. The conserved cysteine residues are shown by + symbols, and the putative furin cleavage signal sequence is underlined. The numbers above the sequence correspond to the number in the original published sequence, and are included for easy reading. 4.2. ZP3 protein similarities The similarities of the ZP3 proteins are shown in table 1. ![]() Table 1. ZP3 amino acid sequence similarities among 13 vertebrate species (in %) 5. DISCUSSION The existing ZP3 deduced aa sequences of 13 vertebrate species were aligned by the PILEUP and PRETTY programs. The aa sequences of carp and frog, which are two lower vertebrate species and far distantly related to the 11 mammalian species, showed extremely divergent alignment at the N- and C-termini, but normal alignment in the central region. The consensus aa sequences from all the 13 vertebrate species came out almost the same, which indicates the overall conservation of the ZP3 protein. Structurally, three regions of the sequence alignment could be detected. These are: 1).putative leader sequences and the first 20-25 amino acid of the mature protein (between position 1 to 129); 2).the central region (in position 130 to 401); and 3).the C-terminal region of the protein (between position 402 to 518). However, the extremely divergent alignments of carp and frog with other 11-mammalian species make the leader sequence more prominent. All the ZP proteins showed a putative transmembrane domain (27) near the C-terminus. The canonical furin proteolytic processing signal (R-X-R/K-R) (28) occurs just prior to the transmembrane domain in all species except carp and frog. The transmembrane domain might be removed from the mature protein at the furin processing site. The higher variations in the N- and C-termini could lead to species-specificity. An epitope of murine ZP3 (NSSSSQFQIHGPR, from position 412 to 426) in the central region occurring immediately before the furin proteolytic cleavage site has been identified by a monoclonal antibody which blocks fertilization (25). A synthetic human ZP3 peptide (GTPSHSRRQPHVMS, from position 411 to 426) has also been examined for the contraceptive potential (26). However, there is very little homology among various species in this region of the ZP3 protein. This region might contribute towards the species-specificity of sperm-egg binding. The six relatively conserved sequences in the central region were found. These include: 1). 22 amino acids from position 129 to 151: VTVSKDLFGTGKLIRP ADLTLG; 2). 54 amino acids from position 189 to 242: LVYSTFLLHDPRPGNLSILRTNRAEVPIECRYPRQGVS SQAILPTWVPFRTT; 3). 24 amino acids from position 275 to 298: AHLQAEVHTGSHVPLRLFVDHCVA; 4). 16 amino acids from position 309 to 324: SPYHTIVDFHG CLVDG; 5). 28 amino acids from position 331 to 358: SAFKAPRPRPDTLQFTVDVFHFANDSRN; and 6). 24 amino acids from position 378 to 401: LNKACSFSKSSN SWFPVEGPADIC. There are 11 conserved cysteine residues in the central region across all the species including carp and frog, indicating that these residues have a longer evolutionary history. Also, the conservation of large numbers of cysteine residues in the central region indicates the overall better evolutionarily conservation of this region. The highest protein similarities were observed between the members of the same order within the class mammalia. For examples, the percentage of similarity between mouse and hamster (rodenta) is 83.9%; between dog and cat (carnivora) 83.5%; between human and monkey (primate) 95.5%; and between porcine and cow (ungulata) 84.3%. However, an exception was observed, i.e., pig (ungulata) was found to have the highest similarity (95.4%) with rabbit (lagomorpha). The high similarity between the members of dissimilar orders indicate that ZP3 aa sequences alone may not be enough to build a phylogenetic tree. The morphological change and molecular divergence are quite independent events, responding to different evolutionary pressure and following different set of rules (29). Therefore, studies that incorporate both molecular and morphological data will provide much better description and interpretation of biological diversity. In conclusion, our analysis indicates that the amino acid sequence of ZP3 is evolutionarily conserved among 13 mammalian species examined, with the central region relatively better conserved. There are several consensus sequences identified including 6 in the central region. If antibodies to these consensus sequences inhibit fertilization, they may provide potential attractive candidates for a contraceptive vaccine applicable to various vertebrate/mammalian species. 5. ACKNOWLEDGMENTS We thank Dr. R. Santhanam for helpful suggestions. This work was supported in part by NIH grant HD24425 to R.K.N. 6. REFERENCES 1. Wassarman, PM: The biology and chemistry of fertilization. Science 235: 553-560 (1987) 2. Bleil JD & Wassarman PM: Structure and function of the zona pellucida: identification and characterization of the proteins of the mouse oocyte’s zona pellucida. Dev Biol 76, 185-202 (1980a) 3. Shimizu S, Tsuji M & Dean J: In vitro biosysthesis of three sulfated glycoproteins of murine zonae pellucidae by oocytes grown in follicle culture. J Biol Chem 259, 5858-5863 (1983) 4. Bleil JD & Wassarman PM: Galactose at the nonreducing terminus of O-linked oligosaccharides of mouse egg zona pellucida glycoprotein ZP3 is essential for the glycoprotein sperm receptor activity. Proc Natl Acad Sci USA 85, 6778-6782 (1988) 5. Kinloch RA, Sakai Y & Wassarman PM: Mapping the mouse ZP3 combining site for sperm by exon swapping and site-directed mutagenesis. Proc Natl Acad Sci USA 92, 262-267 (1995) 6. Wassarmam, PM: Zona pellucida glycoproteins. Annu Rev Biochem 57, 415-442 (1988) 7. Bleil JD & Wassarman PM: Mammalian sperm-egg interaction: identification of a glycoprotein in mouse egg zonae pellucidae possessing receptor activity for sperm. Cell 20, 873-882 (1980b) 8. Ringuette MJ, Sobieski DA, Chamow SM & Dean J: Oocyte-specific gene expression: molecular characterization of a cDNA coding for ZP3, the sperm receptor of the mouse zona pellucida. Proc Natl Acad Sci USA 83, 4341-4345 (1986) 9. Ringuette MJ, Chamberlin ME, Baur AW, Sobieski DA & Dean J: Molecular analysis of cDNA coding for ZP3, a sperm binding protein of the mouse zona pellucida. Dev Biol 127, 287-295 (1988) 10. Kinloch RA, Ruiz-Seiler B & Wassarman PM: Genomic organization and polypeptide primary structure of zona pellucida glycoprotein hZP3, the hamster sperm receptor. Dev Biol 142, 414-421(1990) 11. Schwoebel E, Prasad S, Timmons TM, Cook R, Kimura H, Niu EM, Cheung P, Skinner S, Avery SE, Wilkins B & Dunbar BS: Isolation and characterization of a full-length cDNA encoding the 55-kDa rabbit zona pellucida protein. J Bio Chem 266, 7214-7219 (1991) 12. Yurewicz EC, Hibler D, Fontenot GK, Sacco AG & Harris J: Nucleotide sequence of cDNA encoding ZP3a , a sperm-binding glycoprotein from zona pellucida of pig oocyte. Biochem Biophys Acta 1174, 211-214 (1993) 13. Harris JD, Hibler DW, Fontenot GK, Hsu KT, Yurewica EC & Sacco AG: Cloning and characterization of zona pellucida genes and cDNAs from a variety of mammalian species: The ZPA, ZPB and ZPC gene families. DNA sequence. J Seq Map 4, 361-393 (1994) 14. Chamberlin ME & Dean J: Human homolog of the mouse sperm receptor. Proc Natl Acad Sci USA 87, 6014-6018 (1990) 15. Kolluri SK, Kaul R, Banerjee K & Gupta SK: Nucleotide sequence of cDNA encoding bonnet monkey (Macaca radiata) zona pellucida glycoprotein-ZP3. Reprod Fertil Dev 7, 1209-1212 (1995) 16. Thillai-Koothan P, van Duin M & Aitken RJ: Cloning, sequencing and oocyte-specific expression of the marmoset sperm receptor protein, ZP3. Zygote 2, 1-9 (1993) 17. Chang YS, Wang SC, Tsal CC & Huang FL: Molecular cloning, structural analysis, and expression of carp ZP3 gene. Mol Reprod Dev 44, 295-304 (1996) 18. Kubo H, Kawano T, Tsubuki S, Kawashima S, Katagiri C & Suzuki A: A major glycoprotein of Xenopus egg vitelline envelop, gp41 is a frog homolog of mammalian ZP3. Dev Growth Differ 39, 405-417 (1997) 19. van Duin M, Polman JEM, DeBreet ITM, Van Ginneken K, Bunschoten H, Grootenhuis A, Brindle J & Aitken RJ: Recombinant human zona pellucida protein ZP3 produced by chinese hamster ovary cells induces the human sperm acrosome reaction and promotes sperm-egg fusion. Biol Reprod 51, 607-617 (1994) 20. Dunbar BS, Lo C, Powell J & Stevens VC: Use of a synthetic peptide adjuvant for immunization of baboons with denatured pig ZP glycoproteins. Fertil Steril 52, 311-318 (1989) 21. VanderVoort CA, Schwoebel ED & Dunbar BS: Immunization of monkeys with recombinant complimentary DNA expressed ZP proteins. Fertil Steril 64, 538-547 (1995) 22. Sacco AG, Pierce DL, Subramanian MG, Yurewicz EC & Dukelow WR: Ovaries remain functional in squirrel monkeys (Saimiri sciureus) immunized with porcine zona pellucida 55,000 macromolecule. Biol Reprod 36, 481-490 (1987) 23. Skinner SM, Mills T, Kirchick JH & Dunbar BS: Immunization with zona pellucida proteins results in abnormal ovarian follicular differentiation and inhibition of gonadotropin-induced steroid secretion. Endocrinol 115, 2418-2432 (1984) 24. Paterson M, Wilson MR, Van Duin M & Aitken RJ: Evaluation of zona pellucida antigens as potential candidates for immunocontraception. J Reprod Fertil Suppl 50, 175-182 (1996) 25. Millar SE, Chamow SM, Baur AW, Olive C, Robey F & Dean J: Vaccination with a synthetic ZP peptide produces long term contraception in female mice. Science 246, 935-938 (1989) 26. Bagavant H, Fusi FM, Baisch J, Kurth BK, David CS & Tung, KSK: Immunogenicity and contraceptive potential of a human zona pellucida 3 peptide vaccine. Biol Reprod 56, 764-770 (1997) 27. Klein P, Kanehisa M & Delisi C: The detection and classification of membrane-spanning proteins. Biochem Biophys Acta 815, 468-476 (1995) 28. Hosaka M, Nagahama M, Kim WS Watanabe T, Hatsuzawa K, Ikemizu J, Murakami K & Nakayama K: Arg-X-Lys/Arg-Arg motif as a signal for precursor cleavage catalyzed by furin within the constitutive secretory pathway. J Biol Chem 266, 12127-12130 (1991) 29. Wilson AC, Sarich VM & Maxson LR: The importance of gene rearrangement in evolution: Evidence from studies of rates of chromosomal, protein, and anatomical evolution. Proc Natl Acad Sci USA 71, 3028-5065 (1974) |