[Frontiers in Bioscience 16, 2598-2621, June 1, 2011]
Biomineralization of bone: a fresh view of the roles of non-collagenous proteins
Jeffrey Paul Gorski1
1
TABLE OF CONTENTS
1. ABSTRACT
The impact of genetics has dramatically affected our understanding of the functions of non-collagenous proteins. Specifically, mutations and knockouts have defined their cellular spectrum of actions. However, the biochemical mechanisms mediated by non-collagenous proteins in biomineralization remain elusive. It is likely that this understanding will require more focused functional testing at the protein, cell, and tissue level. Although initially viewed as rather redundant and static acidic calcium binding proteins, it is now clear that non-collagenous proteins in mineralizing tissues represent diverse entities capable of forming multiple protein-protein interactions which act in positive and negative ways to regulate the process of bone mineralization. Several new examples from the author's laboratory are provided which illustrate this theme including an apparent activating effect of hydroxyapatite crystals on metalloproteinases. This review emphasizes the view that secreted non-collagenous proteins in mineralizing bone actively participate in the mineralization process and ultimately control where and how much mineral crystal is deposited, as well as determining the quality and biomechanical properties of the mineralized matrix produced.
2. INTRODUCTION
Mineralization of bone represents an extracellular process in which osteoblastic and osteocytic cells remain viable embedded within a matrix of their making. While mature bone matrix is predominantly composed of type I collagen, the ubiquitous expression of collagen indicates that additional factors are needed to initiate and control the formation of hydroxyapatite crystals which are deposited predominantly between the collagen fibrils. In general, investigation of the process of bone formation and mineralization has been difficult because of the restricted location of the forming sites, the temporal movement of the mineralization front as mineralization proceeds, and the mineralized nature of the bone tissue. This has necessitated a reliance upon cell culture models to generate concepts and paradigms which are then tested in explant or whole animal models. This review represents an overview of both in vitro and in vivo model systems and attempts to integrate data from both sources to reach functional concepts regarding the roles of each of the major non-collagenous proteins in biomineralization of bone.
3. PROPOSED MECHANISMS OF MINERAL NUCLEATION IN BONE
New bone formation in the vertebrate embryo is produced by two distinct condensation processes: intramembranous, which forms and persists in the calvaria and jaws, and endochondral, which forms the long bones. In intramembranous bone formation, woven or primary bone is rapidly formed without a cartilaginous precursor, whereas endochondral bone uses a previously formed vascularized cartilage template (1). Primary bone is formed in situations where a rapid deposition of bone is required-embryogenesis, fracture healing, and adaptive bone gain after mechanical loading (~3000 microstrain) (2). In adult skeletons, the two distinct types of bone formation may have common but also unique molecular and cellular control mechanisms. Primary bone is defined as bone that forms where no bone existed previously. In contrast, lamellar or mature bone can be viewed as "replacement bone" formed when bone (either woven or lamellar bone) is resorbed by osteoclasts and then replaced by new lamellar bone. "Modeling" and "remodeling" are applied to the formation of primary bone and lamellar bone, respectively. In both primary and lamellar bone, initial hydroxyapatite crystal nucleation is mediated by organic molecules. There are two essential events in mineralization: the first is nucleation of mineral to produce crystals with a C-axis length of between 15 and 20 nm (3) and the second is mineral crystal propagation, also known as the crystal growth phase (4). Several cell-derived structures have been proposed to be responsible for the initiation and control of the mineral nucleation event. These include: matrix vesicles (5-8), biomineralization foci (9-11), 'crystal ghosts' (12), calcospherulites (13), phosphoproteins-collagen fibrils (14, 15) and fetuin (16, 17). The contribution of each of these to the initial nucleation event continues to be debated but it is likely that their relative contributions will vary in different tissues or developmental stages.
3.1. Biomineralization Foci
We have shown that 10-25 micron in diameter BMF are the sites of initial mineral nucleation in three osteoblast cell lines, in developing periosteum, and in new primary bone produced by marrow ablation model (9, 10). Interestingly, pre-BMF can be visualized prior to addition of extra phosphate to the cultures and, following addition, nucleation of hydroxyapatite crystals occurs exclusively within BMF starting as soon as 12 h later. Proteomic analyses on laser capture micro dissected mineralized BMF indicate they are enriched in acidic phosphoproteins BSP and BAG-75, along with a range of different sized vesicles (50 nm to 2 �m) including matrix vesicles (11). Banded collagen fibrils do not appear to be present within these pre-BMF. Vesicles within BMF are the sites of initial mineral nucleation (9-11. 18, 19). Although BSP is associated with the first needle-like crystals produced in developing bone or culture models, it has not been reported to be a component of matrix vesicles. In this way, BSP appears to define a biochemically distinct population of particles which are larger than matrix vesicles and which can also become mineralized (10, 18). Importantly, based on a shared enrichment in BSP and their structure and tissue distribution, Bonucci recently concluded that crystal ghosts are a mineralized tissue equivalent of BMF in osteoblastic cultures (20).
Recently we showed that mineral nucleation within UMR106-01 and fetal mouse calvarial osteoblastic cells could be blocked by 100 �M AEBSF, a covalent serine protease inhibitor, without impacting cell viability (11). In contrast, fifteen general and specific inhibitors against acidic, metallo-, and sulfhydryl proteases were without effect. Partial fragmentation of BMF biomarkers BSP and BAG-75 was also inhibited by AEBSF, along with that for procollagen C-terminal propeptidase enhancer1 (PCOLCE1) and 1,25-vit. D3-MARRS protein (Membrane Associated, Rapid Response Steroid binding receptor). The 50 kDa fragment of BAG-75 was detected using antibodies against the N-terminal peptide (VARYQNTEEEE) (21); in separate studies we have shown that these antibodies detect a 50 kDa band in serum which is induced 3-fold in rats stimulated to undergo new bone formation (unpublished result, Gorski). Subsequent work has sought to establish the mechanism for AEBSF action.
A detailed literature search identified a candidate protease sensitive to AEBSF inhibition, proprotein convertase SKI-1 (S1P) (22). Analysis of BSP, 1,25-D3-MARRS (Membrane Associated, Rapid Response Steroid binding receptor), and procollagen C-proteinase enhancer protein 1 (PCOLCE1), three proteins whose cleavage is blocked by AEBSF (14), reveals each contains several SKI-1 candidate cleavage sequences which appear capable of generating the observed fragments (unpublished result, Huffman, Seidah and Gorski). We have also recently shown that a catalytically active 105 kDa form of SKI-1 (23, 24) is highly expressed within laser capture microscope purified BMF (25).
3.2. Calcospherulites
Midura et al. (29, 30) recently isolated calcospherulites (from the mineralization front of tibial periosteum) and used them to induce the mineralization of type I collagen in vitro. Calcospherulites were identified as 0.5 um diameter particles which had taken up calcein within the 24 h following in vivo injection. The particles exhibited a Ca/P ratio of 1.3 which rose to 1.6 after treatment with ice cold ethanol and were enriched in bone matrix phosphoproteins BSP and BAG-75. When incubated in collagen hydrogels, calcospherulites seeded a mineralization reaction on type I fibrils. When compared with BMF from osteoblastic cells, we conclude that calcospherulites represent mineralized vesicles comparable to those which are the sites of initial mineral deposition within BMF. We believe their membrane bilayer acts as a barrier to proteolysis and permits their isolation based upon their mineral and calcein content, whereas we presume other BMF components are degraded by the dispase used (28,29). In this way, calcospherulites likely represent a protease resistant, mineral containing fraction of BMF (9-11, 18).
3.3. Matrix vesicles
First identified and characterized by Bonucci (31) and by Anderson (32), matrix vesicles have a long and controversial history in bone. However, recent work with BMF and calcospherulites indicates that matrix vesicles, and other vesicles, are present in bone and in mineralizing osteoblastic cultures (9-11, 18, 28, 29). However, while recent work shows that mineral crystals in developing bone are deposited within vesicles (8, 33), it does not show that matrix vesicles are the exclusive sites of mineral deposition in bone. Rather, careful analysis suggests that different sizes and distinct compositional populations of vesicles exist in mineralizing bone, including matrix vesicles, and participate in the initial mineral deposition.
Xiao Z et al. (34) recently characterized the proteome of extracellular matrix vesicles isolated from mineralizing MC3T3-E1 osteoblasts using proteolysis. This confirmed a number of well known matrix vesicle components, including annexin V, alkaline phosphatase, aminopeptidase A, and Emilin-1. In addition, over 125 other proteins were identified in common between the two matrix vesicle preparation methods compared. The results indicate that the protein composition of matrix vesicles is the result of a molecular sorting process which yields a different more specialized composition than expressed on the plasma membranes of differentiated osteoblastic cells (34).
4. The Role of Individual Non-Collagenous Proteins
As the most prevalent protein in the body, type I collagen is distributed widely among mineralized and non-mineralized tissues. On this basis, it is apparent that type I collagen alone cannot be solely responsible for the unique capacity of bone to mineralize. With the abovementioned initiation systems in mind, we now turn to a consideration of the functional roles of individual non-collagenous proteins. The reader is referred to previous reviews for a more comprehensive treatment of the older literature (3, 35-37).
4.1. Bone Sialoprotein (BSP)
Originally cloned by Fisher and colleagues (38), BSP is thought to be related to the sialoprotein isolated by Herring in 1964 (39). Based on the work of Goldberg and colleagues (40-44), BSP is generally believed to function in bone as a crystal nucleator, although a number of studies demonstrate it is able to signal through its RGD integrin binding site and a second, cryptic cell adhesion site (45, 46). Importantly, Aubin and colleagues have produced a BSP null mouse and characterized its bone phenotype (47-51) with and without skeletal challenge. BSP null mice breed normally but their weight and size is lower than wild type mice. Hypomineralized bone is evident in embryonic and young adult bone, but not in mice over 1 year old (51). At 4 months of age, cortical bone from BSP (-/-) mice is thinner than wild type, but with greater trabecular volume with a very low bone formation rate. BSP null bone also displays fewer osteoclasts. In addition, BSP deficient mice exhibited a delay in healing response at 2 and 3 weeks after formation of cortical defects. In contrast, OPN null mice responded no differently than controls when analyzed by MicroCT or histology. Interestingly, BSP null mice lose bone normally in unloading studies, while OPN null mice do not lose bone (48). In summary, the absence of BSP results in impaired new bone formation and osteoclast activity (47-51). However, the lack of a more dramatic phenotype has been suggested to be due to a functional redundancy with other acidic phosphoproteins in bone.
Gordon et al. (52, 53) have shown that the RGD motif is required to for BSP to induce osteoblastic differentiation. When BSP was over-expressed in primary calvarial osteoblastic cells using a adenoviral vector, Runx2 and Osx expression, alkaline phosphatase, and mineralization were all increased via a pathway involving focal adhesion kinase and MAP kinase associated ERK 1/2 proteins. These findings seem at odds however with the phenotype of transgenic mice over-expressing BSP using the CMV promoter. The mice display mild dwarfism, lower BMD, and lower trabecular bone volume, while expressing higher levels of bone resorption markers indicating increased osteoclastic bone resorption. An explanation for these unexpected in vivo results is not yet evident.
BSP also has effects on bone resorption of osteoclasts. Curtain et al. (54) showed that dephosphorylated bone BSP preferentially inhibited the differentiation of osteoclasts in a live bone organ culture model via an intracellular tyrosine phosphorylation signaling pathway. Native bone BSP had little effect on osteoclast formation and bone resorption, whereas dephosphorylated BSP eliminated PTH-induced bone resorption. These effects were only partially blocked by integrin receptor antagonist GRGDS. Mechanistically, the effects of dBSP appeared to be mediated by down regulation of osteoblastic RANKL production in this bone organ culture system. Physiologically, Curtain et al. (54) believe that dBSP released/produced by active osteoclastic resorption of bone matrix could feedback to cells in the local environment to block or limit the resorption phase. It should be noted that Mintz et al. (45) first identified a non-RGD, cryptic cell adhesion site on BSP which was exposed upon cleavage. In addition, Sato et al. (55) also showed that BAG-75 inhibited osteoclast differentiation as well as resorption by preformed osteoclasts.
Recent work with recombinant BSP demonstrates that phosphorylation of serine-136 is critical for BSP-mediated
nucleation of hydroxyapatite crystals in a steady state assay (44). BSP binding to native type I collagen increased calcium binding by 10-fold compared with free BSP. Serine-136 is a site adjacent to one of two Glu-rich regions previously implicated in hydroxyapatite nucleation, e.g., residues 42-100 and 133-205 (56). Boskey and colleagues have also used diffusion studies within a semi-solid collagenous gel to establish the ability of BSP to nucleate hydroxyapatite crystals (57).
While these data indicate that BSP is the most potent protein nucleator of hydroxyapatite, a role for BSP in the mineralization of collagen is limited by a lack of a mechanism to bind BSP specifically to the hole or gap regions of fibrillar collagen as first proposed by Glimcher (16) and by Veis and Schleuter (15). Since initial mineral crystals were found to be associated with the hole regions in the turkey tendon model of mineralization and since type I collagen is a ubiquitous component of mineralizing as well as non-mineralizing extracellular matrices, these authors argued that the associated phosphoprotein(s), bound to the hole zone of collagen fibrils, acted as a mineralization nucleator. In this way, mineralization of bone extracellular matrix was proposed to be initiated by the formation of seed crystals in the interfibrillary space which would serve to propagate crystal growth within the broader bone matrix. While an attractive hypothesis, the proposal has yet to be validated largely due the absence of a mechanism to localize phosphoproteins to the hole region. However, recent work from our laboratory has provided an interesting potential mechanism for binding of BSP near the hole region of type I collagen fibrils.
As shown in Figure 1, osteoblastic cells in culture initiate mineralization within spherical extracellular complexes we have termed biomineralization foci (BMF). These BMF are compositionally complex and contain matrix vesicles and larger sized vesicles in which the first mineral crystals are formed. We have used laser micro dissection microscopy to isolate and characterize the proteome of BMF. Interestingly, type XI collagen was found to be enriched within micro dissected BMF, specifically, a 60 kDa fragment containing the 6b alternative splice variant sequence (Figure 2). In contrast, another splice variant, 8, while expressed by UMR106-01 osteoblastic cells as a full length 105 kDa alpha 1 chain, is not enriched within BMF (Figure 2). Both the 6b and 8 sequences are part of the N-terminal domain of the type XI alpha 1 chain (58) (Figure 3). The charge character of the NTD can be changed dramatically by alternative splicing since the 6b sequence has an isoelectric point of 11.3 and unusual arginine triplet repeat sequences. In contrast, the alternating 6a sequence is acidic in character. The NTD is a large globular extension. The NTD variable region containing the 6b and 8 sequences survives BMP-1 processing and exists as part of the extracellular, mature type XI collagen trimer (Figure 3) (59).
6b sequence: KKKSNYTKKKRTLATNSKKKSKMSTTPKSEKFASKKKKRNQATAKAKLGVQ
6a sequence: YAPEDIIEYDYEYGETDYKEAESVTEMPTFTEETVAQT
Alternatively, as shown by our culture data, the 6b region can be cleaved off as a 60 kDa fragment (Figures 2 and 3). As illustrated in Figure 4, the 60 kDa 6b containing type XI NTD fragment associates specifically with bone sialoprotein. Mineralized osteoblastic cell cultures were extracted with EDTA, which removes predominantly material associated with BMF (11), and then immunoprecipitated with anti-BSP antibodies. Interestingly, BSP and the 60 kDa type XI NTD region were only recovered from cultures which mineralized, not those inhibited with AEBSF (Figure 4). Other studies show that the 60 kDa band reacts with anti-6b type XI collagen antibodies and anti-Npp antibodies establishing it as the complete NTD domain (data not shown) (Figure 3).
Taken together we believe these results provide a new novel mechanism by which to localize mineral nucleator protein BSP to the surface of collagen fibrils. Specifically, type XI collagen has been shown to play a critical role in the initiation of type I and II collagen fibrillogenesis, and, in the regulation of fibril diameter (60). As indicated by the model in Figure 5, the 6b sequence of the variable region of the COL11 A1 chain is believed to be expressed on the surface of type I collagen fibrils (61). We propose that BSP can bind to the cationic 6b sequence either as a 60 kDa fragment within mineralizing BMF (Figures 2 and 4) or as present in the BMP-1 processed COL A1 chain exposed on the surfaces of type I collagen fibrils (Figure 5). In this way, BSP/type XI collagen complexes could act as local nucleators to initate mineralization of collagen fibrils. The fact that BSP and the 6b containing 60 kDa type XI collagen fragment are also enriched within BMF suggests that BMF and collagen mineralization may share in part a common mechanism for mineral crystal nucleation.
4.2. Noggin
Noggin, along with Chordin, is a bone morphogenetic protein (BMP) antagonist. During mouse embryogenesis, Noggin is expressed at multiple sites, including developing bones. Interestingly, Nog (-/-) mice die at birth from multiple defects that include bony fusion of the appendicular skeleton (62, 63). Groppe J et al. (64) reported the crystal structure of the antagonist noggin bound to BMP-7, which showed that noggin blocks the molecular interfaces of the binding epitopes for both type I and type II receptors. Importantly, the affinity of site-specific variants of noggin for BMP-7 correlated with changes in bone formation and apoptosis in chick limb development, showing that these complexes are biologically inactive.
4.3. Chordin
Chordin dorsalizes early vertebrate embryonic tissues by binding to bone morphogenetic proteins and, like noggin, sequestering them in latent complexes. Scott et al. (65) showed that over-expression of BMP1 and TLL1 in Xenopus embryos counteracted the developmental effects of chordin. Mechanistically, BMP1 and mTLL-1 cleave chordin at sites similar to procollagen C-propeptide cleavage sites. Other BMP-1 family members mTLD and mTLL-2 do not, however, cleave chordin. Interestingly, Wardle et al. (66) showed that noggin was not affected by over-expression of BMP-1 (and presumably not cleaved by it). Based on expression and its enzymatic activity, BMP-1 is the major chordin antagonist in early mammalian embryogenesis and in pre- and postnatal skeletogenesis.
4.4. Osteopontin (OPN)
OPN is an RGD-containing, variably phosphorylated member of the SIBLING family of non-collagenous matrix proteins. It is expressed in bone and bone marrow by osteoblastic and osteoclastic precursor cells, multi-nucleated osteoclasts, osteocytes, and osteoblasts (67-69). Franzen et al. (70) showed that OPN null mice did not experience age related bone loss. Specifically, measures of osteoclast function were several fold lower, despite an increase in the volume and number of osteoclastic cells in the lower tibial metaphysis which was hypothesized as a compensatory change to overcome the observed inactivity of osteoclasts. These findings indicate that OPN is required for osteoclastic resorption of bone (70). Asou et al. (71) also found that osteopontin deficient calvarial bone was inefficiently resorbed when implanted in osteopontin null mice compared with controls. The osteoclast deficiency observed here seemed to be due to reduced angiogenesis in the OPN null mice since it could be reversed by applying OPN protein to the deficient calvarial bone surface prior to its implantation in OPN deficient mice. These results demonstrate that OPN is required both for vascularization and subsequent osteoclastic resorption of bone (71).
A central role for OPN in the metabolic regulation of bone is also supported by the finding that PTH induced bone resorption does not occur in the absence of OPN (72). OPN deficiency also enhanced the formative response of long bones of null mice to intermittent PTH injections relative to that of control mice (73).
OPN has long been believed to function as an inhibitor of calcification reactions (74) by binding specifically to the growing faces of mineral crystals. However, the extent of phosphorylation is a critical modulator of OPN-mineral interactions (74, 75). For example, recombinant OPN and dephosphorylated OPN had no effect on hydroxyapatite crystal formation or growth. In contrast, milk OPN, which contains >30 phosphates/mole, promotes hydroxyapatite formation in static assays (74). In this context, Hunter et al. (76) has recently reviewed the topic of non-collagenous protein mediated biomineralization, e.g., the interaction of nucleator proteins with calcium and phosphate ions. They conclude that the widely held concept of epitaxic crystal initiation may not fit current evidence. Their review of existing data and new energy minimization calculations indicates that most known crystal-bone acidic protein interactions are electrostatic in nature and depend primarily upon the inherent high electronegative charge density of these interactions rather than upon a particular stereochemical conformation. As a result, Hunter et al. (76) have put forth a thoughtful alternate hypothesis, e.g., the flexible polyelectrolyte hypothesis of protein-biomineral interaction.
4.5. Osteopontin, bone sialoprotein, and DMP1 form individual complexes with MMPs
Fedarko and colleagues have shown that three SIBLING proteins form specific high affinity complexes with several individual proMMPs (pro-metalloproteinases) and their active forms expressed in skeletal tissues (77). BSP complexes with proMMP-2 and active MMP-2, while osteopontin binds proMMP-3 and active MMP-3, and DMP1 binds proMMP-9 and active MMP-9. For MMP-2, BSP is also able to induce catalytic activity in latent pro-MMP-2 as well as to rescue active enzyme from TIMP2-MMP-2 inhibitory complexes (78, 79). All complexes were disrupted by competition with serum complement factor H suggesting that analogous physiological SIBLING complexes are likely to be limited to sequestered areas near cells. Interestingly, bound MMPs displayed a diminished susceptibility to their respective natural and synthetic inhibitors (77) which may be particularly relevant to the invasive behavior of cancer cells which jointly express high levels of MMPs and these SIBLING proteins (80).
4.6. Bone acidic glycoprotein-75
BAG-75 is defined by its N-terminal sequence (LPVARYQNTEEEE) and its immunoreactivity with an anti-protein antibody, an anti-peptide antibody against its N-terminal sequence, and a monoclonal antibody (21, 81, 82). A highly acidic, phosphoprotein isolated from and enriched in primary or intramembranous bone (3), BAG-75 binds more calcium ions (133 atoms/mole) than either BSP or OPN on a molar basis. Functionally, when added to differentiated osteoclasts or to differentiating osteoclast culture models, BAG-75 inhibits bone resorption (55). In contrast to BSP or OPN, BAG-75 displays a propensity to self-associate into macromolecular complexes which have the capacity to also trap or sequester large numbers of phosphate ions (83). Operationally, BAG-75 has served as a useful immunoreactive biomarker for areas in osteoblastic cultures and in healing bone which will subsequently become mineralized (11, 19).
4.7 Dentin matrix protein 1
Originally thought to be expressed only in cementoblasts, ameloblasts, osteoblasts, and odontoblasts (84), DMP1 is now known to be also enriched in osteocytes (85). DMP1 is cleaved by BMP-1 into a 55 kDa C-terminal fragment and 35 kDa N-terminal fragment (86, 87). Using furin-deficient cells, von Marschall and Fisher (86) compared three different isoforms of BMP1 and each displayed different activities. In contrast to collagen cleavage by BMP-1, DMP1 cleavage showed no enhancement by procollagenase enhancer protein. DMP1 mediates cell adhesion via its RGD site with alphavbeta3 receptors on cells. RGD binding was the same for full length and C-terminal fragment, however, a proteoglycan form of DMP1 was much less active in cell adhesion assays. (88).
Tartaiz et al. (89) showed that non-phosphorylated recombinant DMP1 acted as a hydroxyapatite nucleator in a gelatin gel static diffusion system while DMP1 phosphorylated in vitro has no effect on crystal growth or formation. Phosphorylated DMP1 synthesized by marrow stromal cells (30 phosphates/mole) however acted as an inhibitor of hydroxyapatite crystal growth and formation. These results seem to indicate that the position of phosphorylation is important for DMP1 to function as a mineralization inhibitor. In vivo, DMP1 exists predominantly in tissues as two highly phosphorylated fragments of 57 kDa and 35 kDa. The 57 kDa fragment also acted as a hydroxyapatite nucleator. Gajjeraman et al. (90) has also shown that the N-terminal fragment of DMP1 acted as a mineralization inhibitor. However, in contrast to Tartaiz et al. (89), they also found that both full-length recombinant DMP1 and post-translationally modified native DMP1 were able to nucleate hydroxyapatite in the presence of type I collagen. This disparity may be due in part to the purity of the DMP1 fragment tested since it is now appreciated that two fragments are derived from the N-terminus, a chondroitin sulfate linked fragment and a 37 kDa polypeptide (91). The proteoglycan fragment acts as a mineralization inhibitor while the remaining 57 kDa and 37 kDa fragments both promoter hydroxyapatite crystal formation and growth in vitro.
Physiologically, the function of DMP1 in mineralized tissues is closely tied to systemic phosphate regulation. DMP1 null mice and patients with DMP1 mutations exhibit autosomic hypophosphatemic rickets (92, 93). Over-expression of either full-length DMP1 or the 57 kDa C-terminal fragment in the DMP1-null strain largely rescued the skeletal phenotype in mice suggesting that the latter fragment is able to recapitulate the function of full-length DMP1 (94). It can be assumed that the reduced mineralization detected in DMP1 null bone (95) may be largely due to the hypophosphatemia which is a characteristic of the skeletal phenotype (96). The hypophosphatemia of DMP1 null mice is associated with elevated levels of FGF23, a well known negative regulator of systemic phosphate concentration, although the exact mechanism remains unclear (96).
4.8. Osteocalcin
Thought to be the most bone restricted protein produced by osteoblastic cells, osteocalcin is unusual in that it is post-translationally modified at up to three glutamic acid residues (GLA)/mole by gamma-carboxylation in a vitamin K dependent enzymatic mechanism (97). Due to its acidic character and GLA residues osteocalcin was initially presumed to be an important regulator of bone mineralization. However, the phenotype of osteocalcin knockout mice is mild and displays no major bone abnormalities (98). These results raised serious questions regarding the function of osteocalcin in bone. Recently, Karsenty and colleagues have suggested that osteocalcin functions as a hormone released from bone into the blood to regulate insulin secretion by the beta-cells of the pancreas and to control insulin sensitivity by adipocytes (99). Part of a new complex metabolic feedback loop controlling bone, pancreas, and fat tissue, the active form of osteocalcin is undercarboxylated. In this way, the content of active, undercarboxylated osteocalcin in blood is believed to be derived via osteoclastic bone resorption of bone matrix. The process of osteoclastic resorption is believed to expose bone matrix derived osteocalcin to low pH conditions (<4.5) which lead to its chemical decarboxylation and release to the blood (99). The full pathway remains to be completely elucidated since the receptor on pancreatic and fat cells which recognizes undercarboxylated osteocalcin has not yet been identified. Also, the mechanism requires validation to show that acid mediated decarboxylation of osteocalcin is compatible with the temporal sequence of osteoclastic resorption in vivo. While this pathway has been largely worked out through genetic ablation of various genes in mice, a growing body of supporting evidence indicates that osteocalcin serves as a metabolic hormone in humans as well (100). Thus, this novel osteocalcin paradigm raises the intriguing question whether other bone matrix proteins may also possess hormonal functions regulating other metabolic systems, e.g., systemic calcium and phosphorus ion concentrations, fat storage, etc.
4.9. Fetuin (alpha2HS-glycoprotein)
Fetuin is produced by the liver and by osteoblastic cells (101). Highly acidic, fetuin has the capacity to bind large numbers of calcium ions. As such, fetuin is believed to be a major systemic inhibitor of ectopic calcification in the blood plasma and in tissue fluids (102). As a consequence, fetuin null mice develop micro-calcifications in small blood vessels and increased soft tissue calcification deposits. Interestingly, fetuin also forms a colloid or suspension of fine particles with insoluble calcium phosphate crystals which have been termed calciprotein particles or CPPs (102-105). Jahnen-Dechent and McKee (106) have suggested that CPPs participate in a circulating pathway in plasma to solubilize crystalline calcium deposits and transport finely divided crystal particles among sites of calcium loss (the intestine, kidney, bone). In this sense, recent stopped flow experimental data from this group suggests that the ability of fetuin to inhibit calcification is due to its ability to shield and stabilize early stage protein-mineral complexes as small CPP-like particles rather than permit aggregation of nuclei with subsequent mineral crystal precipitation (107). While very intriguing, the physiological significance CPPs in the process of osteoblast mediated bone formation and mineralization remains to be established. Although likely to be involved, the capacity of fetuin to form and stabilize particulate microcrystals of calcium phosphate (hydroxyapatite) has not been formally tested in the "mineralization by inhibitor exclusion" model proposed by Price et al. (17) (see above). Furthermore, the "calcification activity" detected in serum from humans to fish and sharks and partially characterized by Price and colleagues (108) also seems likely to be due, at least in part, to the fetuin in serum and its associated finely suspended colloidal particles of calcium phosphate.
4.10. Periostin
Kashima et al. (109) showed that periostin is a biomarker for intramembranous bone and is preferentially expressed in the bone produced by individuals with fibrous dysplasia, a benign condition, while not expressed in endochondral bone. Periostin is a disulfide linked GLA-containing 90 kDa protein secreted by osteoblasts and osteoblastic cell lines whose expression is down regulated by phosphate ion and is restricted to the periosteum and periodontal ligament (109, 110). Periostin shows some homology to Betaig-h3, a protein that promotes adhesion and spreading of fibroblasts (111). Betaig-h3 also contains GLA residues. Gamma-carboxylated periostin localizes to mineralized bone nodules formed by mesenchymal stem cells. Periostin knockout mice expressing LacZ were grossly normal at birth, however, 14% of the deficient mice died before weaning. Since all of remaining LacZ positive mice were growth retarded, periostin is required for normal postnatal bone growth (112). In this regard, Bonnet et al. (113) showed that periostin is required for the anabolic response of bone to mechanical loading and physical activity. In its absence, long bones in periostin null mice do not respond anabolically to axial compression loading, whereas periostin (+/+) mice respond normally by increasing bone formation activity especially in the periosteum. Importantly, the biomechanical response of periostin null mice was rescued by injection of sclerostin-blocking antibody. These results indicate that periostin acts to block the actions of sclerostin on bone formation. When combined with the skeletal retardation observed in periostin null mice (112), these results show that periostin is a regulator of bone mass and microstructure in response to loading.
Maruhashi et al. (114) also showed that periostin stimulated the proteolytic activation of lysyl oxidase. Lysyl oxidase mediates the formation of reactive aldehydes on collagen chains which participate in formation of chemical cross-links. However, lysyl oxidase requires proteolytic activation by BMP-1. Interestingly, the amount of active lysyl oxidase was reduced in calvarial osteoblasts from periostin null mice, while over-expression of periostin promoted release of its propeptide and enzymatic activation. Since direct binding studies showed BMP-1 binds to periostin, these results indicate that periostin acts in analogous way to PCOLCE-1, an enhancer protein which increases by up to 20-fold the rate of procollagen processing by BMP-1 (115).
4.11. Tissue Nonspecific Alkaline Phosphatase
While its expression is not restricted to bone, alkaline phosphatase has long been a prominent component of bone mineralization mechanisms due to its high expression in mineralizing tissues, its enrichment within matrix vesicles, and the ease of its functional analysis. TNAP is associated with the external face of surfaces of osteoblastic and chondrocytic cells via a phosphatidylinositol anchor (116, 117) which can be released by a specific phospholipase D (118). The functional role of alkaline phosphatase in mineralization has become somewhat refocused by very recent studies combining the TNAP knockout with that for Phospho 1.
4.12. Phospho 1 phosphatase
Phospho 1 is a phosphatase whose actions are restricted enzymatically to mineralizing cells where it displays a catalytic preference for substrates phosphatidylethanolamine and phosphatidylcholine (119). Phospho 1 is expressed specifically at sites of mineralization of cartilage and bone in osteoblasts and newly formed osteocytes (120). Phospho 1 null mice display growth plate abnormalities, spontaneous fractures, bowed long bones, osteomalacia, and scoliosis in early life. The fact that over-expression of TNAP does not prevent the development of skeletal abnormalities in the Phospho1 null mice, despite correction of plasma PPi levels and of greatly elevated TNAP levels, suggests that Phospho 1 functions through a pathway that is distinct from that of TNAP (8).
As a component of matrix vesicles, it has been suggested that Phospho 1 could produce free phosphate for initiation of matrix mineralization using phosphatidylethanolamine and phosphatidylcholine lipids in matrix vesicles (121). Previous models of mineralization in bone and cartilage have emphasized a role for alkaline phosphatase. However, while deficiency of alkaline phosphatase does diminish the mineral density of bone and growth plate cartilage in young TNAP knockout mice, careful transmission electron microscopic analyses revealed that initiation of mineralization still occurred within vesicles of TNAP deficient bone (32). These findings suggested that hypo-mineralization in TNAP-deficient mice results primarily from an inability of mineral crystals to proliferate beyond the limits of the vesicular membrane. This failure of the second (proliferation) stage of mineralization may be caused by an excess of pyrophosphate inhibitor in the surrounding extracellular fluid. As proposed by Millan and Terkeltaub and colleagues, the concentration of mineralization inhibitor pyrophosphate is regulated by the balance between its breakdown by alkaline phosphatase and its production by PC-1 (ENPP1) (122).
Functionally, Phospho 1 is required to initiate de novo mineral crystals within matrix vesicles. For example, treatment of mesenchymal micromass cultures with lansoprazole, a small inhibitor of Phospho 1 resulted in reduced Alizarin red staining. In situ hybridization showed that expression of Phospho 1 preceded mineralization (and correlated with TNAP). Importantly, treatment of developing embryos for 5 days with lansoprazole completely inhibited mineralization of all leg and wing long bones as assessed by Alcian blue/Alizarin red staining (123). Yadav et al. (8) simultaneously knocked out Phospho 1 and TNAP and showed that the double knockout was completely devoid of skeletal mineralization and exhibited perinatal lethality, despite relatively normal systemic phosphate levels. They concluded that Phospho 1 has a non-redundant functional role during endochondral ossification and proposed an inclusive model of calcification that places Phospho 1 phosphatase action within vesicles in the initiation of mineralization and the functions of TNAP, nucleotide pyrophosphatase phosphodiesterase-1 and collagen in the extravesicular progression (propagation) of mineralization. The reader is referred to the publication by Yadav et al. (8) for a more complete description of their "unified model of mineralization".
4.13. Ectonucleotide Pyrophosphatase/Phosphodiesterase (ENPP1)
A transmembrane glycoprotein with a short cytoplasmic tail, single transmembrane segment, and an extracellular C-
terminal domain, ENPP1 helps to regulate bone and cartilage mineralization by producing inorganic pyrophosphate. The enzyme exhibits both 5'-nucleotide phosphodiesterase I and nucleotide pyrophosphohydrolase activities (124). Based on the results of a double knockout of alkaline phosphatase and ENPP1, the Millan and Terkeltaub labs suggested that these two enzymes each served to balance the activity of the other. Specifically, the double knockout corrects bone mineralization abnormalities which occur in single deletions of each individual enzyme (122). As noted above, recent work with Phospho 1 has clarified the potential roles of ENPP1 both as a 1) producer of pyrophosphate mineralization inhibitor and 2), under conditions of limiting alkaline phosphatase activity, as a producer of extracellular inorganic phosphate via its phosphodiesterase activity to feed the growth and propagation of mineral crystals (8).
4.14. Biological Effects of Hydroxyapatite on Bone Matrix Proteins
Hydroxyapatite is the major crystalline form of calcium phosphate in bone and cartilage tissues. However, hydroxyapatite is thought to be biologically inert. Several studies raise the prospect that hydroxyapatite crystals can modify cellular MMP production and function in bone. First, exposure of fibroblasts or breast cancer cells to hydroxyapatite, calcium pyrophosphate, or basic calcium phosphate crystals induces mitogenesis as well as increases the transcription and expression of MMP-1 and MMP-3 (125-127). In all cases, endocytosis is required for crystals to induce synthesis of MMPs. The effect of calcium phosphate crystals could be abrogated by phosphocitrate, although the mechanism is unclear. Second, we have shown that hydroxyapatite crystals are able to alter dramatically the functional activity of MMP-1 and MMP-3 (83). Specifically, these MMPs, when bound, changed their substrate specificity such that each catalyzed their own autolytic degradation in an intermolecular, calcium-dependent process. Interestingly, other proteases including MMP-2, trypsin, chymotrypsin, papain, and zinc-dependent thermolysin were all unaffected by exposure to hydroxyapatite crystals (83).
Recent work with PHEX (phosphate regulating endoprotease homolog, x-linked) further supports an active role for hydroxyapatite crystals in bone function. PHEX is a single pass transmembrane endoprotease which regulates systemic phosphate metabolism since its mutational inactivation causes x-linked hypophosphatemia (128). Specifically, we have found that a 60 kDa, catalytically active fragment of PHEX is enriched within mineralized biomineralization foci purified by laser micro dissection from osteoblastic cultures (Figure 6). BMF are the initial sites of mineral nucleation within at least three different osteoblastic culture models (9-11, 18, 19). Initial proteomic characterization revealed that mineralized BMF were physically enriched in phosphoproteins BSP and BAG-75 (2-4). However, we have continued to investigate over 35 other matrix proteins and calcium or phosphate channels/transporters as candidate constituents of BMF. Thus far, only four proteins have been found to be physically enriched within BMF complexes, e.g., BSP (9-11, 18), BAG-75 (9-11, 18), Phex, and type XI collagen (see Figure 2 above). This point is illustrated in Figure 6, which shows the specificity of this enrichment through comparisons with 110 kDa full length MEPE and a 57 kDa fragment of DMP1, which are notably not enriched in mineralized BMF. Because BMF are detectable before mineralization and become the exclusive sites of initial mineral production/deposition in osteoblastic cultures, we hypothesize that these enriched proteins and their fragments work together to mediate this unique function of BMF complexes, e.g., mineral crystal nucleation.
PHEX is an endoprotease which is structurally related to the M13 family of proteases. We have found that PHEX also exhibits a limited homology with MMP-3 (matrix metalloproteinase-3 or stromelysin), another zinc-dependent metalloprotease. A two way BLAST comparison of these sequences
Phex: 538-NAFYSASTNQ I R - - FPAG-553 (identities noted with bold symbols)
MMP-3: 358-NQFWAIRGNEVRAGYPRG-375
reveals a statistically significant homology of 33% with the #538-553 PHEX peptide region depicted; four other peptides were also found to share a 30-40% identity with MMP-3 (not shown). Homologies >25-30% are generally considered "real" and likely reflect at least a partial shared evolutionary history. The homology with the #538-553 peptide may be particularly important because this region is believed to represent part of the PHEX substrate binding domain (10), whereas in MMP-3 it comprises part of the C-terminal hemopexin domain.
This newly identified structural relationship suggests that PHEX may share functional properties with MMP-3. Because PHEX is localized preferentially to mineralized BMF (Figure 6) and because the substrate binding domain of PHEX exhibits a limited structural homology with MMP-3 (see above), we asked whether the 60 kDa fragment of PHEX observed in BMF was produced by autolytic cleavage induced by exposure to hydroxyapatite crystals. Figure 7 shows that 60 kDa PHEX is preferentially produced only when recombinant 98 kDa PHEX is incubated with hydroxyapatite crystals in the presence of ASARM peptide. Recombinant 98 kDa PHEX is missing its single transmembrane spanning domain near the N-terminus and a small intracellular domain at the N-terminus of the native protein (129, 130). We conclude that PHEX was induced to cleave itself, as seen for MMP-1 or MMP-3 (83), upon exposure to hydroxyapatite crystals. Since a similar sized 60 kDa fragment was detected by Western blotting of both recombinant PHEX (Figure 7) and of laser micro dissected BMF complexes (Figure 6), we hypothesize that a single hydroxyapatite induced autolytic cleavage site for PHEX is located in the N-terminal half of the sequence yielding a 60 kDa fragment sharing the same C-terminus for both. This is further supported by the fact that Western blots used anti-PHEX antibodies specific for a peptide very near the zinc-binding domain of PHEX (gift of Dr. P. S. Rowe, Univ. of Kansas). Second, we hypothesized that the 60 kDa fragment contained the catalytic region (zinc binding domain and substrate binding site) of PHEX (130), e.g., the 60 kDa fragment was catalytically active.
As shown in Figures 8A and 8B, both PHEX activity and the 60 kDa PHEX fragment content are both 2-3 fold higher in crude osteoblast plasma membrane preparations isolated from mineralized UMR106-01 osteoblastic cultures exposed to hydroxyapatite crystals as compared with that where mineralization was blocked by serine protease inhibitor AEBSF (11) or by omission of exogenous phosphate. Our results strongly suggest that an active 60 kDa PHEX fragment is produced by exposure to hydroxyapatite crystals during the process of mineralization occurring within biomineralization foci. We speculate that the 60 kDa PHEX could exhibit altered enzymatic properties relative to the 98 kDa recombinant isoform and/or the 105 kDa full-length membrane bound isoform. In this way, 60 kDa PHEX could provide a local or systemic feedback signal marking the initiation of mineralization, e.g., to mobilize additional phosphate ions to feed the growth of the new mineral phase.
4.15. Sclerostin
Encoded by its gene Sost, Sclerostin is a secreted glycoprotein highly expressed by osteocytes. Inactivating mutations in humans leads to a rare high bone mass condition called sclerosteosis. Transgenic knockout of Sclerostin in mice also leads to increased bone formation and bone strength (131). These findings demonstrate that Sclerostin functions as an anabolic inhibitor, a blocker of bone formation. Its mechanism of action on osteoblasts/osteocytes appears to involve strong protein-protein interactions/complexes with Periostin, Noggin, and cysteine-rich protein 61. Cysteine-rich protein 61 (Cyr 61) regulates mesenchymal stem cell proliferation and differentiation, osteoblast and osteoclast function, and angiogenesis (132). Bonnet et al. (113) used mechanical stimuli to show that periostin is required for the anabolic response to mechanical loading and physical activity. Administration of anti-Sclerostin blocking antibody to periostin (-/-) null mice rescued the anabolic bone formation response to biomechanical stimuli which had previously been blocked by this transgenic deletion (131). Availability of Sclerostin is also regulated by its interactions with Noggin, with whom it forms tight, mutually inhibitory complexes (2.9 x
10-9 M) (133). The formation of the Sclerostin-Noggin complex directly neutralizes BMP binding activity and attenuates the effects of these two BMP antagonists. As a result, the net biological effect of Sclerostin may depend upon its balance between various binding partners in the extracellular matrix.
4.16. Tenascin C
A large oligomeric extracellular matrix glycoprotein, Tenascin is also known as hexabrachion or cytotactin due to its hexameric quaternary structure with six arms linked to a central globular domain (134). Its expression is restricted to vertebrate development where it appears during neural crest cell migration and later at sites of cartilage, bone, and tendon formation. Tenascin can function to promote neurite outgrowth in vitro and can inhibit cell interactions with fibronectin, where each of these functional interactions is mediated by distinct cell binding sites. Tenascin-C has been proposed to be involved in the development of articular cartilage and in the mechanism by which articular chondrocytes avoid the endochondral ossification process (which occurs with bulk of metaphyseal and diaphyseal chondrocytes) (135). Condensation is a crucial stage in skeletal development. It occurs when a previously dispersed population of cells gathers together to differentiate into a single cell or tissue type (136). Extracellular matrix molecules, receptors and adhesion molecules such as fibronectin, tenascin-C, syndecan, and N-CAM initiate condensation and set condensation boundaries. Hox genes and other factors like BMPs regulate the proliferation of cells within condensations. Growth of a condensation ceases when Noggin inhibits BMP signaling-which sets up the next stage in development which is overt cell differentiation (135). However, tenascin-C deficient mice generated by two groups (137, 138) show no apparent skeletal phenotype, e.g., normal development and adulthood, life span, and fecundity, as well as normal healing of skin and nerves.
4.17. Phosphate-regulating neutral endopeptidase (PHEX)
Identification of the genetic targets of X-linked hypophosphatemia, autosomal dominant hypophosphatemic rickets (ADHR), X-linked hypophosphatemia (XLH), autosomal recessive hypophosphatemia (ARHP), and hereditary hypophosphatemic rickets with hypercalciuria (HHRH) has identified at least eight genes whose function is required either indirectly or directly to control the systemic phosphate concentration in blood (139-141). One of these is zinc endoprotease PHEX (phosphate-regulating gene with homologies to endopeptidases on the X chromosome) (142). Loss of function mutations in the Pex gene cause X-linked hypophosphatemic rickets. A Pex mutation is also responsible for the 'hyp' mouse skeletal phenotype: hypophosphatasia and elevated FGF23 expression (143). The precise function of PHEX is unclear although two genetic rescue studies using bone restricted promoters have demonstrated it has a direct, local effect on bone mineralization as well suggest it has an indirect effect on systemic phosphate homeostasis (129, 144). This conclusion is also supported by results of transplantation of mutant Hyp or control periostea into wild type or phosphate supplemented Hyp mice and into control or phosphate-depleted normal mice (145). Also, over-expression of human PHEX under the beta-actin promoter seemed to rescue the bone mineralization defect, but did not affect phosphate homeostasis suggesting again independent physiological mechanisms control hyperphosphaturia and bone mineralization in XLH and Hyp (146). Since all three transgenic attempts to replace mutant PHEX in the Hyp mouse were able to at least partially rescue bone mineralization, it is widely believed that PHEX has a role in mineralization of bone.
Using a small peptide substrate, Liu et al (147) showed that MEPE binding to PHEX inhibits the peptidase activity of the latter enzyme. Subsequently, McKee and co-workers showed that PHEX can cleave and inactivate the mineralization inhibitory activity of some ASARM peptide isoforms derived from MEPE (148). However, the most highly phosphorylated forms, which are also the predicted to be the most effective minhibins (mineral crystal growth inhibitors), were not effectively cleaved by Phex. Minhibins is the term coined by Rowe and colleagues to refer to the ASARM peptides representing highly conserved, acidic, protease-resistant C-terminal regions of SIBLING proteins DMP1, BSP and MEPE (149). This latter group has shown that degradation of MEPE, DMP1, and release of SIBLING ASARM-peptides (minhibins) is dramatically increased in the HYP (Phex-deficient) mouse and that ASARM-peptide(s) are directly responsible for defective mineralization in the HYP skeleton (148, 149). It appears that cathepsin B, a neutral protease, may mediate the accelerated release of ASARM peptides in HYP mice since cathepsin inhibitors rescue the defect (150). While these findings explain a number of features of the bone phenotype associated with loss of PHEX in man and mice, they do not clarify the role of PHEX in normal mineralization of bone.
4.18. Matrix extracellular phosphoglycoprotein (MEPE, OF45)
MEPE, matrix extracellular phosphoglycoprotein, was first isolated from tumor tissue from a patient with oncogenic hypophosphatemia and is capable of inhibiting kidney tubular phosphate re-absorption (151) and absorption by the intestine (152)-features ascribed to phosphatonins, substances acting on multiple organs to regulate phosphate metabolism. It is also highly expressed in osteocytes as compared to osteoblasts. Deletion of this gene in mice results in increased bone formation and bone mass and less trabecular bone loss with age (153) whereas over-expression of MEPE caused a growth and mineralization defect with altered vascularization of bone and kidney (154). MEPE contains a highly phosphorylated C-terminal region called the ASARM peptide. Based on work with recombinant proteins, PHEX binding to MEPE regulates the proteolytic release of ASARM peptides which act as potent inhibitors of mineralization in the HYP mouse (147) and in X-linked hypophosphatasia (155).
4.19. Functional importance of proteolysis in activation of transglutaminase and PCOLCE
Transglutaminase and PCOLCE (procollagen C-proteinase enhancer) are both required for normal bone formation and mineralization. PCOLCE is a 55 kDa precursor with an elongated structure that enhances the C-terminal processing of type I, II, and III collagen precursors catalyzed by BMP-1 (procollagen C-terminal propeptidase) (156). Following proteolytic activation, a 36 kDa active PCOLCE fragment mediates the effect on BMP-1 via its two CUB domains (157, 158). The C-terminal netrin-like domain of PCOLCE shares sequence homology with a similar domain in metalloproteinases. Although inactive with MMP-2, BMP-1, and ADAMTS, the netrin-like domain can accelerate procollagen processing in the presence of heparin or heparan sulfate glycosaminoglycan chains (159). Thus, PCOLCE alone can increase collagen processing about 10-fold (157), whereas a further increase in rate can be accomplished in association with cell surface heparan sulfate proteoglycans (159). Heparan sulfate proteoglycans are common components of most cell surfaces including osteoblasts.
Interestingly, PCOLCE (-/-) male mice possess larger long bones with altered geometries that increase resistance to loading compared with wild type bones. Female (-/-) long bones did not show this change. Under mechanical testing, null male long bones revealed diminished material properties which apparently were compensated for by adapative changes in bone geometry, e.g., making the bones bigger. For PCOLCE (-/-) vertebrae, both sexes exhibited diminished mechanical properties relative to controls. Similar to the male long bones, knockout vertebrae were thickened and had more numerous trabeculae with abnormal mineral crystal morphology. All of these findings appear consistent with the observed presence of abnormal collagen fibrils in both mineralized and non-mineralized tissues (160). Thus, PCOLCE is also a determinant of the mechanical and geometrical properties of bone in mammals mediating its effects through fibrillar collagens I, II, and III. It is particularly interesting that treatment of mineralizing osteoblastic cells with covalent serine protease inhibitor AEBSF blocks the activation of PCOLCE-1, while also blocking mineralization (11). Based on these results, activation of PCOLCE represents a protease regulated step in the mineralization pathway resulting in increased collagen fibrillogenesis and deposition.
Since transglutaminases, of which seven TGase genes have been cloned thus far, also require proteolytic activation, we questioned whether this step is also regulated similarly to that for PCOLCE. All TGase enzymes possess a conserved cys-his-asp catalytic triad and a calcium-binding domain although individual differences exist, e.g., TGM1 is a transmembrane enzyme and TGM2 contains a unique C-terminal GTPase/ATPase signaling region (161). The properties and enzymatic functions of TGase I, II, III, and Factor XIII are the most thoroughly studied. Individual TGases are the target genes in several human syndromes: Lamellar Ichthyosis of the skin (TGM1); Peeling Skin Syndrome (TGM5); and unstable blood clots and increased bleeding tendency (Factor XIII). However, at present, a requirement for transglutaminase for mineralization of bone is yet to be firmly established since the TGase II (-/-) mouse exhibits no developmental or postnatal skeletal defects (162, 163). In view of the multiple copies of TGase and their wide distribution, it is likely that functional redundancy could be operative particularly since Factor XIII is expressed by osteoblast lineage cells (164) and is present in plasma.
Despite this, the work of Kartinen and colleagues suggests that transglutaminase II is functionally important for bone formation. They showed that mineralization of MC3T3-E1 (subclone 14) pre-osteoblastic cultures could be blocked completely by treatment with cystamine, a TGase inhibitor (165). Osteoblast differentiation was also blocked as expression of bone sialoprotein, osteocalcin and alkaline phosphatase was diminished. Within bone and in osteoblastic cultures, osteopontin, collagen, and osteocalcin have been consistently shown to be substrates for transglutaminase catalyzed crosslinking (166, 167). Intramolecular crosslinking of osteopontin increases its collagen binding properties five-fold (168). While these, and other (169), studies imply TGase activity may influence bone cell signaling directly or indirectly, supporting conclusive mechanistic evidence is not available. Furthermore, it is unclear whether other transglutaminase isoforms, e.g., TGase III, could also be expressed by osteoblastic cells in vivo. Finally, other than for Factor XIII and thrombin, the identity of the cleavage site and of the physiological protease mediating initial activation of bone transglutaminases remains unknown.
4.20. Neutral Proteases in Bone
While specific examples of protease actions in bone development and mineralization are given above, it is likely that other functions for proteases in bone will be identified, aside from those associated with osteoclastic bone resorption. For example, during in vitro differentiation of tibial derived rat osteoblasts, expression is increased for MMP-2 and MMP-9 and membrane gelatinase MMP-14. These proteases, along with TIMP-1 and TIMP-2, are developmentally regulated in accordance with the maturation stage of the osteoblastic cells. MMP-14 is expressed in differentiating osteoblastic cells and is localized in cells forming nodules. MMP-14 expression in vivo in rat tibias (day 7) also shows the highest levels among osteogenic cells, in lining osteoblasts on the newly formed trabeculae under the growth plate and on the endosteal surface of cortical bone (170). MMP-2 (gelatinase-A) and MMP-9, also known as 72 kDa and 92 kDa type IV collagenase, respectively, specifically cleave type IV collagen a major component of basement membranes. No bone phenotype has yet been reported in MMP-2 or MMP-9 null mice (171, 172). BMP-1, a Zn+2 metalloproteinase, catalyzes biosynthetic processing of most collagens expressed by bone cells as well as other extracellular proproteins. Actually, BMP-1 comprises a family of four closely related enzymes which may display a redundancy in function (65). This latter point may explain the absence of a dramatic phenotype in BMP-1 null mice (173). Interestingly, transgenic deletion of caspase-3 leads to delayed ossification and decreased bone mineral density (174) due in part to impaired differentiation of bone marrow stromal stem cells. MT1-MMP is a transmembrane protease which acts on extracellular matrix components in the pericellular environment. Its deletion causes no detectable embryonic abnormality, but rather brings about progressive postnatal changes, e.g., craniofacial dysmorphism, osteopenia, arthritis, and dwarfism as well as fibrosis of soft tissues (175, 176). Clarification of a potential mechanism for these changes was provided by Holmebeck K et al (177). They showed that collagen cleavage in osteocytes from mice deficient in MT1-MMP was disrupted and ultimately led to the loss of formation of osteocyte cell processes called dendrites important in inter-cellular communication. A potential implication from these static studies is that MTI-MMP mediates an active invasive collagen degradation process during osteocyte embedding.
SKI-1 is a member of the proprotein convertase family of serine proteases (178). PCs are required to process or mature the structure of growth factors, neuropeptides, toxins, glycoproteins, viral capsid proteins, and transcription factors. Transmembrane transcription factor precursors SREBP-1 and -2 are activated in a sequential process involving first SKI-1 cleavage and then S2P protease cleavage (179). After activation, the N-terminal fragments of SREBP-1 and SREBP-2 can be imported into the nucleus where they regulate gene expression by binding to transcriptional promoters containing consensus SRE sequences (180). CREB/ATF family transcription factors (ATF-6, LUMAN (CREB3), OASIS/BBF2H7 (CREB3L2), CREB-H, CREB-4, and AIbZIP/Tisp40 (CREB3L4)) also include transmembrane proteins which require SKI-1 catalyzed release of an N-terminal transcriptionally active fragment. SKI-1 is also an initiator of the unfolded protein response and acts generally to decrease cellular stress by increasing chaperone production, influencing ER-associated degradation of proteins, and regulating membrane remodeling (181).
Recent studies suggest a functional role for SKI-1 in normal bone formation (22). First, the skeletons of mice deficient in SKI-1 activatable transcription factor OASIS exhibit a severe osteopenia characterized by a type I collagen-deficient bone matrix and reduced osteoblastic activity (182, 183). Second, mice over-expressing ICER, a dominant negative effector of CREB/ATF transcription factors, displayed dramatically reduced trabecular bone and a markedly reduced femoral bone formation rate (184). Third, SKI-1 is required for normal cartilage morphogenesis in zebra fish (185). In a similar way, conditional inactivation of SKI-1 in mice using a type II collagen Cre recombinase transgene displayed abnormal calcification of the growth plate (186). Homozygous germ-line deletion of SKI-1 is embryonic lethal in mice (187). Finally, we have recently shown that inhibition of SKI-1 in osteoblastic cultures blocks the deposition of mineral crystals by blocking the expression of mineralization related proteins PHEX, type XI collagen, fibronectin, and DMP1 (188).
5. SUMMARY AND PERSPECTIVE
The role of extracellular non-collagenous proteins, cell surface and secreted, in biomineralization has evolved dramatically from initial considerations of calcium binding and cell adhesion. While detailed structure/function relationships are still under investigation, it is now clear that some proteins, such as osteocalcin, act as systemic hormones which serve to integrate the metabolic function of bone, fat and nervous tissues. Others, such as sclerostin, periostin, act as local regulators of the Wnt pathway regulating the osteocyte's response to mechanical loading. Fetuin is now well established as a product of bone cells as well as hepatocytes and plays a role in vascular calcium particle transport. Interestingly, it is now possible to assign roles during biomineralization. Phosphatase Phospho 1, a vesicular component, is required to form the initial mineral crystals in vitro and in vivo, while alkaline phosphatase and ENPP1 appear to be needed to propagate or grow these initial crystals. Phex, DMP1, and MEPE all participate in the regulation of systemic phosphate, an ion critical for forming calcium hydroxyapatite. Newly identified protein-protein interactions like that proposed for bone sialoprotein and a specific, cationic, alternative splice variant of type XI collagen allow us to localize phosphoprotein nucleators at the gap regions of collagen fibrils within mineralizing osteoid. Also, bone sialoprotein is capable of rescuing catalytically active MMP-2 from previously inactive TIMP-MMP-2 complexes. Recent studies also suggest that hydroxyapatite crystals themselves may directly influence the catalytic function of metalloproteinases present within mineralized bone and cartilage. Finally, it now appears that expression of a number of mineralization related extracellular matrix proteins may be regulated in a common pathway. However, further work is needed to determine the extent to which the catalytic and inhibitor specificities of individual enzymes such as PHEX can be modified. Conceptually as well, the model of bone biomineralization proposed by Hunter et al. (76) has moved from a fixed epitaxic view of protein-mineral crystal interactions consistent with invertebrate shells to a less organized "flexible polyelectrolyte" model which reflects two decades of structural studies on acidic phosphoproteins such as osteopontin and bone sialoprotein.
6. Acknowledgements
JPG wishes to thank Mrs. Nichole T. Huffman for her excellent work in performing experimental work described here as well as the ongoing support of the UMKC Bone Group, the Center of Excellence in Mineralized Tissues, and the faculty of the Oral Biology Department of UMKC. Special thanks also to collaborators Drs. R.J. Midura, Julie T. Oxford, Peter Rowe, L. Darryl Quarles, and Nabil G. Seidah. Supported by NIH grant AR052775, UMKC Center of Excellence in Mineralized Tissues, the Patton Trust and the Kansas City Life Science Board, and the University of Missouri Research Board.
7. References
1. Bjorn R. Olsen: Bone Embryology. In: Primer on the Metabolic Bone Diseases and Disorders of Mineral Metabolism. Ed: Murry J. Favus, American Society for Bone and Mineral Research, Washington, DC (2006)
2. Charles H. Turner, T A. Woltman, D A. Belongia: Structural changes in rat bone subjected to long-term, in vivo mechanical loading. Bone 13, 417-422 (1992)
3. Jeffrey P. Gorski: Is all bone the same? Distinctive distributions and properties of non-collagenous matrix proteins in lamellar vs. woven bone imply the existence of different underlying osteogenic mechanisms. Crit Rev Oral Biol Med 9, 201-223 (1998)
doi:10.1177/10454411980090020401
PMid:1992064
4. Edward D. Simmons Jr., Kenneth P. Pritzker, Marc D. Grynpas: Age-related changes in the human femoral cortex. J Orthop Res 9, 155-167 (1991)
doi:10.1002/jor.1100090202
5. Ermanno Bonucci: Comments on the ultrastructural morphology of the calcification process: an attempt to reconcile matrix vesicles, collagen fibrils, and crystal ghosts. Bone and Mineral 17, 219-222 (1992)
doi:10.1016/0169-6009(92)90740-5
6. H. Clarke Anderson: Molecular biology of matrix vesicles. Clin Orthop Relat Res 314, 266-280 (1995)
PMid:10956650
7. Theodore Kirsch, Gerald Harrison, Ellis E. Golub, Hyun-Duck Nah: The roles of annexins and types II and X collagen in matrix vesicle mediated mineralization of growth plate cartilage. J Biol Chem 275, 35577-35583 (2000)
doi:10.1074/jbc.M005648200
8. Manisha C. Yadav, Ana M. Simão, Sonoko Narisawa, Carmen Huesa, Marc D. McKee, Colin Farquharson, Jose Luis Millán: Loss of skeletal mineralization by the simultaneous ablation of PHOSPHO1 and alkaline phosphatase function - A unified model of the mechanisms of initiation of skeletal calcification. J Bone Miner Res Aug 3 (2010) (Epub ahead of print)
PMid:15004029
9. Jeffrey P. Gorski, Amin Wang, Dina Lovitch, Douglas Law, Kathyrn Powell, Ronald J. Midura: Extracellular bone acidic glycoprotein-75 defines condensed mesenchyme regions to be mineralized and localizes with bone sialoprotein during intramembranous bone formation. J Biol Chem 279, 25455-25463 (2004)
doi:10.1074/jbc.M312408200
PMid:15004030
10. Ronald J. Midura, Amin Wang, Dina Lovitch, Douglas Law, Kathyrn Powell, Jeffrey P. Gorski: Bone acidic glycoprotein-75 delineates the extracellular sites of future bone sialoprotein accumulation and apatite nucleation in osteoblastic cultures. J Biol Chem 279, 25464-25473 (2004)
doi:10.1074/jbc.M312409200
PMid:17613519 PMCid:2805412
11. Nichole T. Huffman, John A. Keightley, Cui Chaoying, Ronald J. Midura, Dinah Lovitch, Patricia A. Veno, Sarah L. Dallas, Jeffrey P. Gorski: Association of specific proteolytic processing of bone sialoprotein and bone acidic glycoprotein-75 with mineralization within biomineralization foci. J Biol Chem 282, 26002-26013 (2007)
doi:10.1074/jbc.M701332200
PMid:7554948
12. Ermanno Bonucci: Ultrastructural organic-inorganic relationships in calcified tissues: cartilage and bone versus enamel. Connect Tissue Res 33, 157-162 (1995)
doi:10.3109/03008209509016996
PMid:10475573
13. J E. Aaron, B Oliver, N Clarke, D H. Carter, D.H: Calcified microspheres as biological entities and their isolation from bone. Histochem J 31, 455-470 (1999)
doi:10.1023/A:1003707909842
PMid:2672881
14. Melvin J. Glimcher: Mechanism of calcification: role of collagen fibrils and collagen-phosphoprotein complexes in vitro and in vivo. Anat Rec 224, 139-153(1989)
doi:10.1002/ar.1092240205
PMid:14235325
15. Arthur Veis, R J. Schlueter: The macromolecular organization of dentine matrix collagen. 1. Characterization of dentine collagen. Biochemistry 3, 1650-1657 (1964)
doi:10.1021/bi00899a009
PMid:14263157
16. Melvin J. Glimcher, C J. Francois, L Richards, Stephen M. Krane: The presence of organic phosphorus in collagens and gelatins. Biochim Biophys Acta 93, 585-602 (1964)
PMid:19414589 PMCid:2719347
17. Paul A. Price, D Toroian, J E. Lim: Mineralization by inhibitor exclusion: the calcification of collagen with fetuin. J Biol Chem 284, 17092-17101 (2009)
doi:10.1074/jbc.M109.007013
PMid:10753913
18. Aimin Wang, James A. Martin, Lois A. Lembke, Ronald J. Midura: Reversible Suppression of in vitro Biomineralization by Activation of Protein Kinase A. J Biol Chem 275, 11082-11091(2000)
doi:10.1074/jbc.275.15.11082
PMid:19116206 PMCid:2652278
19. Chianyi Wang, Yang Wang, Nichole T. Huffman, Chaoying Cui, Yao, Sharon Midura, Ronald J. Midura, Jeffrey P. Gorski: Confocal laser raman microspectroscopy of biomineralization foci in UMR 106 osteoblastic cultures reveals temporally synchronized protein changes preceding and accompanying mineral crystal deposition. J Biol Chem 284, 7100-7113 (2009)
doi:10.1074/jbc.M805898200
PMid:2394708
20. Ermanno Bonucci: In Biological Calcification, Normal and Pathological Processes in the Early Stages, p.195. Springer-Verlag, New York.
21. Jeffrey P. Gorski, David Griffin, Gerry Dudley, Clarke Stanford, Randy Thomas, Conway Huang, Eugene Lai, Bradley Karr, Micheal Solursh: Bone acidic glycoprotein-75 is a major synthetic product of osteoblastic cells and localized as 75- and/or 50-kDa forms in mineralized phases of bone and growth plate and in serum. J Biol Chem 265, 14956-14963 (1990)
PMid:18728345 PMCid:2824183
22. Jeffrey P. Gorski, Nichole T. Huffman, Chaoying Cui, Ellen Henderson, Sharon B. Midura, Nabil G. Seidah: Potential role of proprotein convertase SKI-1 in the mineralization of primary bone. Cells Tissues Organs 189, 25-32 (2009)
doi:10.1159/000151723
PMid:11756446
23. Aram S. Elagoz, Suzanne Benjannet, Aida Mammarbassi, Louise Wickham, Nabil G. Seidah: Biosynthesis and cellular trafficking of the convertase SKI-1/S1P: ectodomain shedding requires SKI-1 activity. J Biol Chem 277, 11265-11275 (2002)
doi:10.1074/jbc.M109011200
24. Nabil G. Seidah, Seyed J. Mowla, Josee Hamelin, Aida M. Mamarbachi, Suzanne Benjannet, Barry B. Touré, Ajoy Basak, Jon Scott Munzer, Jadwiga Marcinkiewicz, Mei Zhong, Jean-Christophe Barale, Claude Lazure, Richard A. Murphy, Michel Chrétien, Mieczyslaw Marcinkiewicz: Mammalian subtilisin/kexin isozyme SKI-1: A widely expressed proprotein convertase with a unique cleavage specificity and cellular localization. Proc Natl Acad Sci U S A 96, 1321-1326 (1999)
doi:10.1073/pnas.96.4.1321
25. Jeff P. Gorski, Nichole T. Huffman, Sridar Chittur, Ronald J. Midura, Claudine Black, Julie Oxford, Nabil G. Seidah: Inhibition of SKI-1 Proprotein Convertase Blocks Transcription of Key Extracellular Matrix Genes Regulating Osteoblastic Mineralization. J Biol Chem 285, in press (2010)
PMid:104778
26. Alan Boyde, Jona J. Sela: Scanning electron microscope study of separated calcospherites from the matrices of different mineralizing systems. Calcif Tissue Res 26, 47-49 (1978)
doi:10.1007/BF02013233
27. Ermanno Bonucci: Comments on the ultrastructural morphology of the calcification process: an attempt to reconcile matrix vesicles, collagen fibrils, and crystal ghosts. Bone and Mineral 17, 219-222 (1992)
doi:10.1016/0169-6009(92)90740-5
PMid:10475573
28. Jean E. Aaron, Barry Oliver, Noel Clarke, D. Howard Carter: Calcified microspheres as biological entities and their isolation from bone. Histochem J 31, 455-470 (1999)
doi:10.1023/A:1003707909842
PMid:18765929
29. Ronald J. Midura, A Vasanji, X Su, A Wang, Sharon B. Midura, Jeff P. Gorski: Calcospherulites isolated from the mineralization front of bone induce the mineralization of type I collagen. Bone 41, 1005-1016 (2007)
30. Ronald J. Midura, A Vasanji, X Su, Sharon B. Midura, Jeff P. Gorski: Isolation of calcospherulites from the mineralization front of bone. Cells Tissues Organs 189, 75-9 (2009)
doi:10.1159/000152914
PMCid:2107116
31. Ermanno Bonucci: Fine structure of early cartilage calcification. J Ultrastruct Res 20, 33-50 (1967)
doi:10.1016/S0022-5320(67)80034-0
PMid:14982838 PMCid:1613274
32. H Clarke Anderson: Electron microscopic studies of induced cartilage development and calcification. javascript:AL_get(this, 'jour', 'J Cell Biol.'); J Cell Biol 35, 81-101 (1967)
PMid:17096383
33. H. Clarke Anderson, Joseph B. Sipe, Lovisa Hessle, Rama Dhanyamraju, Elisa Atti, Nancy P. Camacho, Jose Luis Millán: Impaired calcification around matrix vesicles of growth plate and bone in alkaline phosphatase-deficient mice. Am J Pathol 164, 841-847 (2004)
PMid:9084675
34. Zhen Xiao, Corinne E. Camalier, Kunio Nagashima, King C. Chan, David A. Lucas, M. Jason de la Cruz, Michelle Gignac, Stephen Lockett, Haleem J. Issaq, Timothy D. Veenstra, Thomas P. Conrads, Geoge R. Beck Jr: Analysis of the extracellular matrix vesicle proteome in mineralizing osteoblasts. J Cell Physiol 210, 325-335 (2007)
doi:10.1002/jcp.20826
PMid:9084650
35. Adele L. Boskey: Matrix proteins and mineralization: an overview. Connect Tissue Res 35, 357-363 (1996)
doi:10.3109/03008209609029212
36. Pam G. Robey: Vertebrate mineralized matrix proteins: structure and function. Connect Tissue Res 35, 131-136 (1996)
doi:10.3109/03008209609029183
PMid:6355090
37. Chunlin Qin, Otto Baba, William T. Bulter: Post-translational modifications of sibling proteins and their roles in osteogenesis and dentinogenesis. Crit Rev Oral Biol Med 15, 126-136 (2004)
doi:10.1177/154411130401500302
38. Larry W. Fisher, S. William Whitson, Louis V. Avioli, John D. Termine: Matrix sialoprotein of developing bone. J Biol Chem 258, 12723-12727 (1983)
39. Geoffrey M. Herring: (1972) in The Biochemistry and Physiology of Bone (Bourne, G. H., ed) Vol. 1, pp. 127-189, Academic Press, New York.
40. Graeme K. Hunter, Harvey A. Goldberg: Nucleation of hydroxyapatite by bone sialoprotein. Proc Natl Acad Sci U S A 90, 8562-8565 (1993)
doi:10.1073/pnas.90.18.8562
PMid:18620053
41. Graeme K. Hunter, Michael S. Poitras, T. Michael Underhill, Marc D. Grynpas, Harvey A. Goldberg: Induction of collagen mineralization by a bone sialoprotein--decorin chimeric protein. Biomed Mater Res 55, 496-502 (2001)
doi:10.1002/1097-4636(20010615)55:4<496::AID-JBM1042>3.0.CO;2-2
PMid:20377527
42. Jonathan A.R. Gordon, Coralee E. Tye, Arthur V. Sampaio, T. Michael Underhill, Graeme K. Hunter, Harvey A. Goldberg: Bone sialoprotein expression enhances osteoblast differentiation and matrix mineralization in vitro. Bone 41, 462-473 (2007)
PMid:8213261
43. Gurpreet S. Baht, Graeme K. Hunter, Harvey A. Goldberg: Bone sialoprotein-collagen interaction promotes hydroxyapatite nucleation. Matrix Biol 27, 600-608 (2008)
doi:10.1016/j.matbio.2008.06.004
PMid:9258751
44. Gurpreet S. Baht, Jason O'Young, Antonia Borovina, Hong Chen, Coralee E. Tye, Mikko Karttunen, Gilles A. Lajoie, Graeme K. Hunter, Harvey A. Goldberg: Phosphorylation of Ser136 is critical for potent bone sialoprotein-mediated nucleation of hydroxyapatite crystals. Biochem J 428, 385-395 (2010)
doi:10.1042/BJ20091864
PMid:1476819
45. Keith P. Mintz, Wojciech J. Grzesik, Ronald J. Midura, Pamela G. Robey, John D. Termine, Larry W. Fisher: Purification and fragmentation of nondenatured bone sialoprotein: evidence for a cryptic, RGD-resistant cell attachment domain. J Bone Miner Res 8, 985-995, 1993.
doi:10.1002/jbmr.5650080812
PMid:17936099 PMCid:2238032
46. John T. Stubbs 3rd, Keith P. Mintz, Edward D. Eanes, Dennis A. Torchia, Larry W. Fisher: Characterization of native and recombinant bone sialoprotein: delineation of the mineral-binding and cell adhesion domains and structural analysis of the RGD domain. J Bone Miner Res 12, 1210-1222 (1993)
doi:10.1359/jbmr.1997.12.8.1210
PMid:17572166
47. Luc Malaval, Laurent Monfoulet, Thierry Fabre, Laurent Pothuaud, Reine Bareille, Sylvain Miraux, Eric Thiaudiere, Gerard Raffard, Jean-Michel Franconi, Marie-Helene Lafage-Proust, Jane E. Aubin, Laurence Vico, Joelle Amédée: Absence of bone sialoprotein (BSP) impairs cortical defect repair in mouse long bone. Bone 45, 853-861 (2009)
PMid:18458111 PMCid:2373846
48. Laurent Monfoulet, Luc Malaval, Jane E. Aubin, Susan R. Rittling, Alain P. Gadeau, Jean-Christophe Fricain, Olivier Chassande: Bone sialoprotein, but not osteopontin, deficiency impairs the mineralization of regenerating bone during cortical defect healing. Bone 46, 447-452 (2009)
PMid:18728350
49. Ndeye M. Wade-Gueye, Maya Boudiffa, Norbert Laroche, Arnaud Vanden-Bossche, Carole Fournier, Jane E. Aubin, Laurence Vico, Marie-Helene Lafage-Proust, Luc Malaval: Mice Lacking Bone Sialoprotein (BSP) Lose Bone after Ovariectomy and Display Skeletal Site-Specific Response to Intermittent PTH Treatment. Endocrinology 2010 Sep 15. (Epub ahead)
50. Maya Boudiffa, Ndeye M. Wade-Gueye, Alain Guignandon, Arnaud Vanden-Bossche, Odile Sabido, Jane E. Aubin, Pierre Jurdic, Laurence Vico, Marie Helene Lafage-Proust, Luc Malaval: Bone Sialoprotein deficiency impairs osteoclastogenesis and mineral resorption in vitro. J Bone Miner Res 2010 Sep 1. (Epub ahead of print)
51. Luc Malaval, Ndeye M. Wade-Guéye, Maya Boudiffa, Jia Fei, Ralph Zirngibl, Frieda Chen, Norbert Laroche, Jean-Paul Roux, Brigitte Burt-Pichat, Francois Duboeuf, Georges Boivin, Pierre Jurdic, Marie-Helene Lafage-Proust, Joelle Amédée, Laurence Vico, Janet Rossant, Jane E. Aubin: Bone sialoprotein plays a functional role in bone formation and osteoclastogenesis. J Exp Med 205, 1145-1153 (2008)
doi:10.1084/jem.20071294
PMid:19518132 PMCid:2748923
52. Jonathan A. Gordon, Coralee E. Tye, Arthur V. Sampaio, T. Michael Underhill, Graeme K. Hunter, Harvey A. Goldberg: Bone sialoprotein expression enhances osteoblast differentiation and matrix mineralization in vitro. Bone 41, 462-473 (2007)
PMid:1644260
53. Jonathan A. Gordon, Graeme K. Hunter, Harvey A. Goldberg: Activation of the mitogen-activated protein kinase pathway by bone sialoprotein regulates osteoblast differentiation. Cells Tissues Organs 189, 138-143 (2009)
doi:10.1159/000151728
PMid:12493752
54. Paul Curtin, Kevin P. McHugh, Hia-Yan Zhou, Rudolf Flückiger, Paul Goldhaber, Frank G. Oppenheim, Erdjan Salih: Modulation of bone resorption by phosphorylation state of bone sialoprotein. Biochemistry 48, 6876-6886 (2009)
doi:10.1021/bi900066b
PMid:7785899
55. Masahiko Sato, William Grasser, Sandy Harm, Colleen Fullenkamp, Jeffrey P. Gorski: Bone acidic glycoprotein 75 inhibits resorption activity of isolated rat and chicken osteoclasts. FASEB J 6, 2966-2976 (1992)
PMid:17166742 PMCid:2713663
56. Coralee E. Tye, Rattray, Kevin R. Warner, Jonathan A. Gordon, Jaro Sodek, Graeme K. Hunter, Harvey A. Goldberg: Delineation of the hydroxyapatite-nucleating domains of bone sialoprotein. J Biol Chem 278, 7949-7955 (2003)
doi:10.1074/jbc.M211915200
PMid:10820146
57. Adele L. Boskey: Osteopontin and related phosphorylated sialoproteins: effects on mineralization. Ann N Y Acad Sci 760, 249-256 (1995)
doi:10.1111/j.1749-6632.1995.tb44635.x
PMid:12869566
58. Lisa R. Warner, Christina M. Blasick, Raquel J. Brown, Julia T. Oxford: Expression, purification, and refolding of recombinant collagen alpha1(XI) amino terminal domain splice variants. Protein Expr Purif 52, 403-409 (2007)
doi:10.1016/j.pep.2006.10.016
PMid:18442706 PMCid:2398701
59. Nicholas P. Morris, Julia Thom Oxford, Gillian B.M. Davies, Barbara F. Smoody, Douglas R. Keene: Developmentally regulated alternative splicing of the alpha1(XI) collagen chain: spatial and temporal segregation of isoforms in the cartilage of fetal rat long bones. J Histochem Cytochem 48, 725-741 (2000)
PMid:9603738
60. Uwe Hansen, Peter Bruckner: Macromolecular specificity of collagen fibrillogenesis: fibrils of collagens I and XI contain a heterotypic alloyed core and a collagen I sheath. J Biol Chem 278, 37352-37359 (2003)
doi:10.1074/jbc.M304325200
61. David R. Eyre, Mary Ann Weis, Jiann-Jiu Wu: Advances in collagen cross-link analysis. Methods 45, 65-74 (2008)
doi:10.1016/j.ymeth.2008.01.002
PMid:12478285
62. Lisa J. Brunet, Jill A. McMahon, Andrew P. McMahon, Richard M. Harland: Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science 280, 1455-1457 (1998)
doi:10.1126/science.280.5368.1455
PMid:10479448
63. Jill A. McMahon, Shinji Takada, Lyle B. Zimmerman, Chen-Ming Fan, Richard M. Harland, Andrew P. McMahon: Noggin-mediated antagonism of BMP signaling is required for growth and patterning of the neural tube and somite. Genes Dev 12, 1438-1452 (1998)
doi:10.1101/gad.12.10.1438
64. Jay Groppe, Jason Greenwald, Ezra Wiater, Joaquin Rodriguez-Leon, Aris N. Economides, Witek Kwiatkowski, Markus Affolter, Wylie W. Vale, Juan Carlos Belmonte, Senyon Choe: Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature 420, 636-642 (2002)
doi:10.1038/nature01245
PMid:9202251
65. Ian C. Scott, Ira L. Blitz, William N. Pappano, Yasutada Imamura, Timothy G. Clark, Barry M. Steiglitz, Christina L. Thomas, Sarah A. Maas, Kazuhiko Takahara, Ken W.Y. Cho, Daniel S. Greenspan: Mammalian BMP-1/Tolloid-related metalloproteinases, including novel family member mammalian Tolloid-like 2, have differential enzymatic activities and distributions of expression relevant to patterning and skeletogenesis. Dev Biol 213, 283-300 (1999)
doi:10.1006/dbio.1999.9383
PMid:1619274
66. Fiona C. Wardle, Jennifer V. Welch, Leslie Dale: Bone morphogenetic protein 1 regulates dorsal-ventral patterning in early Xenopus embryos by degrading chordin, a BMP4 antagonist. Mech Dev 86, 75-85 (1999)
doi:10.1016/S0925-4773(99)00114-8
PMid:8314886
67. Tomoo Yamate, Hanna Mocharla, Yasuto Taguchi, Joseph U. Igietseme, Stavros C. Manolagas, Etsuko Abe: Osteopontin expression by osteoclast and osteoblast progenitors in the murine bone marrow: demonstration of its requirement for osteoclastogenesis and its increase after ovariectomy. Endocrinology 138, 3047-3055 (1997)
doi:10.1210/en.138.7.3047
PMid:18050311
68. Tohru Ikeda, Shintaro Nomura, Akira Yamaguchi, Tatsuo Suda, Shusaku Yoshiki: In situ hybridization of bone matrix proteins in undecalcified adult rat bone sections. J Histochem Cytochem 40, 1079-1088 (1992)
PMid:11181551
69. Karen Merry, Robert Dodds, Amanda Littlewood, Maxine Gowen: Expression of osteopontin mRNA by osteoclasts and osteoblasts in modelling adult human bone. J Cell Sci 104, 1013-1020 (1993)
PMid:11278791
70. Ahnders Franzén, Kjell Hultenby, Finn P. Reinholt, Patrik Onnerfjord, Dick Heinegård: Altered osteoclast development and function in osteopontin deficient mice. J Orthop Res 26, 721-728 (2008)
doi:10.1002/jor.20544
PMid:12697722
71. Yoshinori Asou, Susan R. Rittling, Hiroyuki Yoshitake, Kunikazu Tsuji, Kenichi Shinomiya, Akira Nifuji, David T. Denhardt, Masaki Noda: Osteopontin facilitates angiogenesis, accumulation of osteoclasts, and resorption in ectopic bone. Endocrinology 142, 1325-1332 (2001)
doi:10.1210/en.142.3.1325
PMid:16007483 PMCid:1451414
72. Hideyo Ihara, David T. Denhardt, Koichi Furuya, Teruhito Yamashita, Yukari Muguruma, Kunikazu Tsuji, Keith A. Hruska, Kanji Higashio, Shoji Enomoto, Akira Nifuji, Susan R. Rittling, Masaki Noda: Parathyroid hormone-induced bone resorption does not occur in the absence of osteopontin. J Biol Chem 276, 13065-13071 (2001)
doi:10.1074/jbc.M010938200
PMid:10766759
73. Keiichiro Kitahara, Muneaki Ishijima, Susan R. Rittling, Kunikazu Tsuji, Hisashi Kurosawa, Akira Nifuji, David T. Denhardt, Masaki Noda: Osteopontin deficiency induces parathyroid hormone enhancement of cortical bone formation. Endocrinology 144, 2132-2140 (2003)
doi:10.1210/en.2002-220996
74. Arne Gericke, Chunlin Qin, Lyudmila Spevak, Fujimoto, William T. Butler, Esben S. Sørensen ES, Adele L. Boskey: Importance of phosphorylation for osteopontin regulation of biomineralization. Calcif Tissue Int 77, 45-54 (2005)
doi:10.1007/s00223-004-1288-1
PMid:14766790
75. Shuichi Jono, Christopher Peinado, Cecilia M. Giachelli: Phosphorylation of osteopontin is required for inhibition of vascular smooth muscle cell calcification. J Biol Chem 275, 20197-20203 (2000)
doi:10.1074/jbc.M909174199
PMid:18465841 PMCid:2484124
76. Graeme K. Hunter, Jason O'Young, Bernd Grohe, Mikko Karttunen, Harvey A. Goldberg: The Flexible Polyelectrolyte Hypothesis of Protein-Biomineral Interaction. Langmuir Jun 8, 2010 (Epub ahead of print).
PMid:18729384 PMCid:2574731
77. Neal S. Fedarko, Alka Jain, Abdullah Karadag, Larry W. Fisher: Three small integrin binding ligand N-linked glycoproteins (SIBLINGs) bind and activate specific matrix metalloproteinases. FASEB J 18, 734-736 (2004)
78. Alka Jain, Larry W. Fisher LW, Neal S. Fedarko: Bone sialoprotein binding to matrix metalloproteinase-2 alters enzyme inhibition kinetics. Biochemistry 47, 5986-5995. (2008)
doi:10.1021/bi800133n
PMid:2846530
79. Alka Jain, Abdullah Karadag, Larry W. Fisher, Neal S. Fedarko: Structural requirements for bone sialoprotein binding and modulation of matrix metalloproteinase-2. Biochemistry 47, 10162-10170.
doi:10.1021/bi801068p
80. Akeila Bellahcène, Vincent Castronovo, Kalu U.E. Ogbureke, Larry W. Fisher, Neal S. Fedarko: Small integrin-binding ligand N-linked glycoproteins (SIBLINGs): multifunctional proteins in cancer. Nat Rev Nat Rev 8, 212-226 (2008)
PMid:9844107
81. Jeffrey P. Gorski, Katsuji Shimizu: Isolation of new phosphorylated glycoprotein from mineralized phase of bone that exhibits limited homology to adhesive protein osteopontin. J Biol Chem 263, 15938-15945 (1988)
PMid:9525343
82 Jeffrey P. Gorski, Edward A. Kremer, Yan Chen, Steve Ryan, Colleen Fullenkamp, John Delviscio, Karen Jensen, Marc D. McKee: Bone acidic glycoprotein-75 self-associates to form macromolecular complexes in vitro and in vivo with the potential to sequester phosphate ions. J Cell Biochem 64, 547-64 (1997)
doi:10.1002/(SICI)1097-4644(19970315)64:4<547::AID-JCB3>3.0.CO;2-R
PMid:11697797
83. Edward A. Kremer, Yan Chen, Ko Suzuki, Hideaki Nagase, Jeffrey P. Gorski: Hydroxyapatite induces autolytic degradation and inactivation of matrix metalloproteinase-1 and -3. J Bone Miner Res 13, 1890-1902 (1998)
doi:10.1359/jbmr.1998.13.12.1890
PMid:14578349
84. Mary MacDougall, Ting Tin Gu, Xinghong Luan, Darrin Simmons, Jinkun Chen: Identification of a novel isoform of mouse dentin matrix protein 1: spatial expression in mineralized tissues. J Bone Miner Res 13, 422-431 (1998)
doi:10.1359/jbmr.1998.13.3.422
PMid:18819913 PMCid:2583300
85. Satoru Toyosawa, Satoru Shintani S, Taku Fujiwara, Takashi Ooshima, Atsushige Sato, Naokuni Ijuhin N, Toshihisa Komori: Dentin matrix protein 1 is predominantly expressed in chicken and rat osteocytes but not in osteoblasts. J Bone Miner Res 16, 2017-2026 (2001)
doi:10.1359/jbmr.2001.16.11.2017
PMid:19524706
86. Zofia von Marschall, Larry W. Fisher: Dentin sialophosphoprotein (DSPP) is cleaved into its two natural dentin matrix products by three isoforms of bone morphogenetic protein-1 (BMP1) Matrix Biol 29, 295-303. Epub Jan 15 (2010)
87. Barry M. Steiglitz, Melvin Ayala, Karthikeyan Narayanan, Anne George, Daniel S. Greenspan: Bone morphogenetic protein-1/Tolloid-like proteinases process dentin matrix protein-1. J Biol Chem 279, 980-986 (2004)
doi:10.1074/jbc.M310179200
PMid:19761880
88. Zofia von Marschall, Larry W. Fisher: Dentin matrix protein-1 isoforms promote differential cell attachment and migration. J Biol Chem 283, 32730-32740 (2008)
doi:10.1074/jbc.M804283200
PMid:17572166
89. Philippe H. Tartaix, Marie Doulaverakis, Anne George, Larry W. Fisher, William T. Butler, Chunlin Qin, Erdjan Salih, Melin Tan, Yukiji Fujimoto, Lyudmila Spevak, Adele L. Boskey: In vitro effects of dentin matrix protein-1 on hydroxyapatite formation provide insights into in vivo functions. J Biol Chem 279, 18115-18820 (2004)
doi:10.1074/jbc.M314114200
PMid:14769788
90. Sivakumar Gajjeraman, Karthikeyan Narayanan, Jianjun Hao, Chunlin Qin, Anne George: Matrix macromolecules in hard tissues control the nucleation and hierarchical assembly of hydroxyapatite. J Biol Chem 282, 1193-1204 (2007)
doi:10.1074/jbc.M604732200
PMid:17052984
91. Gericke A, Qin C, Sun Y, Redfern R, Redfern D, Fujimoto Y, Taleb H, Butler WT, Adele L. Boskey: Different forms of DMP1 play distinct roles in mineralization. J Dent Res 89, 355-359 (2010)
doi:10.1177/0022034510363250
PMid:20200415 PMCid:2873044
92. Jian Q. Feng, Leanne M. Ward, Shiguang Liu, Yongbo Lu, Yixia Xie, Baozhi Yuan, Xijie Yu, Frank Rauch, Siobhan Davis, Shubin Zhang, Hector Rios, Marc K. Drezner, L. Darryl Quarles, Lynda F. Bonewald, Kenneth E. White: Loss of DMP1 causes rickets and osteomalacia and identifies a role for osteocytes in mineral metabolism. Nat Genet 38, 1310-1315 (2006)
doi:10.1038/ng1905
PMid:17033621 PMCid:1839871
93. Bettina Lorenz-Depiereux, Murat Bastepe, Anna Benet-Pagès, Mustapha Amyere, Janine Wagenstaller, Ursula Müller-Barth, Klaus Badenhoop, Stephanie M. Kaiser, Roger S. Rittmaster, Alan H. Shlossberg, Jose L. Olivares, Cesar Loris, Feliciano J. Ramos, Francis Glorieux, Miikka Vikkula, Harald Jüppner, Tim M. Strom: DMP1 mutations in autosomal recessive hypophosphatemia implicate a bone matrix protein in the regulation of phosphate homeostasis. Nat Genet 38, 1248-1250. (1995)
doi:10.1038/ng1868
PMid:17033625
94. Yongbon Lu, Chunlin Qin, Yixia Xie, Lynda F. Bonewald, Jian Q. Feng: Studies of the DMP1 57-kDa functional domain both in vivo and in vitro. Cells Tissues Organs 189, 175-185 (2009)
doi:10.1159/000151727
PMid:18728349 PMCid:2667139
95. Yunfeng Ling, Hector F. Rios, Elizabeth R. Myers, Yongbo Lu, Jian Q. Feng, Adele L. Boskey: DMP1 depletion decreases bone mineralization in vivo: an FTIR imaging analysis. J Bone Miner Res 20, 2169-2177.
doi:10.1359/JBMR.050815
PMid:16294270 PMCid:1456072
96. Shiguang Liu, Jianping Zhou, Wen Tang, Rochelle Menard, Jian Q. Feng, L. Darryl Quarles: Pathogenic role of Fgf23 in Dmp1-null mice. Am J Physiol Endocrinol Metab 295, E254-E261 (2008)
doi:10.1152/ajpendo.90201.2008
PMid:18559986 PMCid:2519751
97. James W. Poser, Fred S. Esch, Nicholas C. Ling, Paul A. Price: Isolation and sequence of the vitamin K-dependent protein from human bone. Undercarboxylation of the first glutamic acid residue. J Biol Chem 255, 8685-8691 (1980)
PMid:6967872
98. Patricia Ducy, Christelle Desbois, Brendan Boyce, Gerald Pinero, Beryl Story, Colin Dunstan, Erica Smith, Jeffrey Bonadio, Steven Goldstein, Caren Gundberg, Allan Bradley, Gerard Karsenty: Increased bone formation in osteocalcin-deficient mice. Nature 382, 448-452 (1996)
doi:10.1038/382448a0
PMid:8684484
99. Mathieu Ferron, Jianwen Wei, Tatsuya Yoshizawa, Andrea Del Fattore, Ronald A. DePinho, Anna Teti, Patricia Ducy, Gerard Karsenty: Insulin signaling in osteoblasts integrates bone remodeling and energy metabolism. Cell 142, 296-308 (2010)
100. Carlo Foresta, Giacomo Strapazzon, Luca De Toni, Lisa Gianesello, Alessandra Calcagno, Catia Pilon, Mario Plebani, Roberto Vettor: Evidence for osteocalcin production by adipose tissue and its role in human metabolism. J Clin Endocrinol Metab 95, 3502-3506 (2010)
doi:10.1210/jc.2009-2557
PMid:7681247
101. Tomokazu Ohnishi, Osamu Nakamura, Masayuki Ozawa, Naokatu Arakaki, Takashi Muramatsu, Yasushi Daikuhara: Molecular cloning and sequence analysis of cDNA for a 59 kD bone sialoprotein of the rat: demonstration that it is a counterpart of human alpha 2-HS glycoprotein and bovine fetuin. J Bone Miner Res 8, 367-377 (1993)
doi:10.1002/jbmr.5650080314
102. Willi Jahnen-Dechent, Cora Schäfer, Alexander Heiss, Joachim Grötzinger: Systemic inhibition of spontaneous calcification by the serum protein alpha 2-HS glycoprotein/fetuin. Z Kardiol 90 (Suppl 3), 47-56 (2001)
doi:10.1007/s003920170042
PMid:12556469
103. Alexander Heiss, Alexander DuChesne, Bernd Denecke, Joachim Grötzinger, Kazuhiko Yamamoto, Thomas Renné, Willi Jahnen-Dechent: Structural basis of calcification inhibition by alpha 2-HS glycoprotein/fetuin-A. Formation of colloidal calciprotein particles. J Biol Chem 278, 13333-13341 (2003)
doi:10.1074/jbc.M210868200
PMid:20408632
104. Alexander Heiss, Willi Jahnen-Dechent, Hisako Endo, Dietmar Schwahn D: Structural dynamics of a colloidal protein-mineral complex bestowing on calcium phosphate a high solubility in biological fluids. Biointerphases 2, 16-20 (2007)
doi:10.1116/1.2714924
PMid:18364352
105. Alexander Heiss, Thomas Eckert, Anke Aretz, Walter Richtering, Wim van Dorp, Cora Schäfer, Willi Jahnen-Dechent: Hierarchical role of fetuin-A and acidic serum proteins in the formation and stabilization of calcium phosphate particles. J Biol Chem 283, 14815-14825 (2008)
doi:10.1074/jbc.M709938200
PMid:18080808
106. Willi Jahnen-Dechent, Cora Schäfer, Markus Ketteler, Marc D. McKee: Mineral chaperones: a role for fetuin-A and osteopontin in the inhibition and regression of pathologic calcification. J Mol Med 86, 379-389 (2008)
doi:10.1007/s00109-007-0294-y
PMid:19222044
107. Christophe N. Rochette, Sabine Rosenfeldt, Alexander Heiss, Theyencheri Narayanan, Matthias Ballauff, Willi Jahnen-Dechent: A shielding topology stabilizes the early stage protein-mineral complexes of fetuin-A and calcium phosphate: a time-resolved small-angle X-ray study. Chembiochem 10, 735-740 (2009)
doi:10.1002/cbic.200800719
PMid:16691496
108. Nicholas J. Hamlin, Karen G. Ong, Paul A. Price: A serum factor that recalcifies demineralized bone is conserved in bony fish and sharks but is not found in invertebrates. Calcif Tissue Int 78, 326-334 (2006)
doi:10.1007/s00223-005-0205-6
PMid:18799196
109. Takeshi G. Kashima, Takashi Nishiyama, Kazuhiro Shimazu, Masahi Shimazaki, Isao Kii, Agamemnon E. Grigoriadis, Masashi Fukayama, Akira Kudo: Periostin, a novel marker of intramembranous ossification, is expressed in fibrous dysplasia and in c-Fos-overexpressing bone lesions. Hum Pathol 40, 226-237 (2008)
doi:10.1016/j.humpath.2008.07.008
110. George R. Beck Jr, Elizabeth Moran, Nicole Knecht: Inorganic phosphate regulates multiple genes during osteoblast differentiation, including Nrf2. Exp Cell Res 288, 288-300 (2003)
doi:10.1016/S0014-4827(03)00213-1
PMid:10404027
111. Keisuke Horiuchi, Norio Amizuka, Sunao Takeshita, Hiroyuki Takamatsu, Mieko Katsuura, Hidehiro Ozawa, Yoshiaki Toyama, Lynda F. Bonewald, Akira Kudo: Identification and characterization of a novel protein, periostin, with restricted expression to periosteum and periodontal ligament and increased expression by transforming growth factor beta. J Bone Miner Res 14, 1239-1249 (1999)
doi:10.1359/jbmr.1999.14.7.1239
PMid:16314533 PMCid:1316984
112. Hector Rios, Shrinagesh V. Koushik, Haiyan Wang, Jian Wang, Hong-Ming Zhou, Andrew Lindsley, Rhonda Rogers, Zhi Chen, Manabu Maeda, Agnieszka Kruzynska-Frejtag, Jian Q. Feng, Simon J. Conway: periostin null mice exhibit dwarfism, incisor enamel defects, and an early-onset periodontal disease-like phenotype. Mol Cell Biol 25, 11131-11144 (2005)
doi:10.1128/MCB.25.24.11131-11144.2005
PMid:19837663
113. Nicholas Bonnet, Kara N. Standley, Estelle N. Bianchi, Vincent Stadelmann, Michelangelo Foti, Simon J. Conway, Serge L. Ferrari: The matricellular protein periostin is required for sost inhibition and the anabolic response to mechanical loading and physical activity. J Biol Chem 284, 35939-35950 (2009)
doi:10.1074/jbc.M109.060335
PMid:20181949
114. Takumi Maruhashi, Isao Kii, Mitsuru Saito, Akira Kudo: Interaction between periostin and BMP-1 promotes proteolytic activation of lysyl oxidase. J Biol Chem 285, 13294-13303 (2010)
doi:10.1074/jbc.M109.088864
PMid:12105202
115. Sylvie Ricard-Blum, Simonetta Bernocco, Bernard Font, Catherine Moali, Denise Eichenberger, Jean Farjanel, Elmar R. Burchardt, Michel van der Rest, Efrat Kessler, David J.S. Hulmes: Interaction properties of the procollagen C-proteinase enhancer protein shed light on the mechanism of stimulation of BMP-1. J Biol Chem 277, 33864-33869 (2002)
doi:10.1074/jbc.M205018200
PMid:3676279
116. Ronald Jemmerson, Martin G. Low: Phosphatidylinositol anchor of HeLa cell alkaline phosphatase. Biochemistry 26, 5703-5709 (1987)
doi:10.1021/bi00392a019
117. Andrew D. Howard, Joel Berger, Louise Gerber, Philip Familletti, Sidney Udenfriend: Characterization of the phosphatidylinositol-glycan membrane anchor of human placental alkaline phosphatase. Proc Natl Acad Sci U S A 84, 6055-6059 (1987)
doi:10.1073/pnas.84.17.6055
118. Atsushi Suzuki, Osamu Kozawa, Jun Shinoda, Yasuko Watanabe, Hidehiko Saito, Yutaka Oiso: Thrombin induces proliferation of osteoblast-like cells through phosphatidylcholine hydrolysis. J Cell Physiol 168, 209-216 (1996)
doi:10.1002/(SICI)1097-4652(199607)168:1<209::AID-JCP25>3.0.CO;2-0
PMid:15175005 PMCid:1133915
119. Scott J. Roberts, Alan J. Stewart, Peter J. Sadler, Colin Farquharson: Human PHOSPHO1 exhibits high specific phosphoethanolamine and phosphocholine phosphatase activities. Biochem J 382, 59-65 (2004)
doi:10.1042/BJ20040511
PMid:12082181 PMCid:123160
120. Brian Houston, Alan J. Stewart, Colin Farquharson: PHOSPHO1-A novel phosphatase specifically expressed at sites of mineralisation in bone and cartilage. Bone 34, 629-637 (2004)
121. Alan J. Stewart, Scott J. Roberts, Elaine Seawright, Megan G. Davey, Robert H. Fleming, Colin Farquharson: The presence of PHOSPHO1 in matrix vesicles and its developmental expression prior to skeletal mineralization. Bone 39, 1000-1007 (2006)
PMid:8910421
122. Lovisa Hessle, Kristen A. Johnson, H. Clarke Anderson, Sonoko Narisawa, Adnan Sali, James W. Goding, Robert Terkeltaub, Jose Luis Millan: Tissue-nonspecific alkaline phosphatase and plasma cell membrane glycoprotein-1 are central antagonistic regulators of bone mineralization. Proc Natl Acad Sci U S A 99, 9445-9449 (2002)
doi:10.1073/pnas.142063399
123. Vicky E. Macrae, Megan G. Davey, Lynn McTeir, Sonoko Narisawa, Manisha C. Yadav, Jose Luis Millan, Colin Farquharson: Inhibition of PHOSPHO1 activity results in impaired skeletal mineralization during limb development of the chick. Bone 46, 1146-1155 (2010)
PMid:20655470
124. Neil F. Rebbe, Benton D. Tong, Elizabeth M. Finley, Scot Hickman: Identification of nucleotide pyrophosphatase/alkaline phosphodiesterase I activity associated with the mouse plasma cell differentiation antigen PC-1. Proc Natl Acad Sci U S A 88, 5192-5196 (1991)
doi:10.1073/pnas.88.12.5192
PMid:15050893
125. Herman S. Cheung, Indira V. Kurup, John D. Sallis, Lawrence M. Ryan: Inhibition of calcium pyrophosphate dihydrate crystal formation in articular cartilage vesicles and cartilage by phosphocitrate. J Biol Chem 271, 28082-28085 (1996)
doi:10.1074/jbc.271.45.28082
PMid:16837257
126. Herman S. Cheung, T.R. Devine, William Hubbard: Calcium phosphate particle induction of metalloproteinase and mitogenesis: effect of particle sizes. Osteoarthritis Cartilage 5, 145-151 (1997)
doi:10.1016/S1063-4584(97)80009-X
PMid:20053388
127. Michelle M. Cooke, Geraldine M. McCarthy, John D. Sallis, Maria P. Morgan: Phosphocitrate inhibits calcium hydroxyapatite induced mitogenesis and upregulation of matrix metalloproteinase-1, interleukin-1beta and cyclooxygenase-2 mRNA in human breast cancer cell lines. Breast Cancer Res Treat 79, 253-263 (2003)
doi:10.1023/A:1023908307108
PMid:12825860
128. A gene (PEX) with homologies to endopeptidases is mutated in patients with X-linked hypophosphatemic rickets. The HYP Consortium. Nat Genet 11, 130-136 (1995)
doi:10.1038/ng1095-130
PMid:7550339
129. Shiguang Liu, Rong Guo, Qisheng Tu, L. Darryl Quarles: Overexpression of Phex in osteoblasts fails to rescue the Hyp mouse phenotype. J Biol Chem 277, 3686-3697 (2002)
doi:10.1074/jbc.M107707200
PMid:11713245
130. Rong Guo, L. Darryl Quarles: Cloning and sequencing of human PEX from a bone cDNA library: evidence for its developmental stage-specific regulation in osteoblasts. J Bone Miner Res 12, 1009-1017 (1997)
doi:10.1359/jbmr.1997.12.7.1009
PMid:9199999
131. Xiaodong Li, Michael S. Ominsky, Qing-Tian Niu, Ning Sun, Betsy Daugherty, Diane D'Agostin, Carole Kurahara, Yongming Gao, Jin Cao, Jianhua Gong, Frank Asuncion, Mauricio Barrero, Kelly Warmington, Denise Dwyer, Marina Stolina, Sean Morony, IIdiko Sarosi, Paul J. Kostenuik, David L. Lacey, W. Scott Simonet, Hua Zhu Ke, Chris Paszty: Targeted deletion of the sclerostin gene in mice results in increased bone formation and bone strength. J Bone Miner Res 23, 860-869 (2008)
doi:10.1359/jbmr.080216
PMid:18269310
132. Theodore A. Craig, Resham Bhattacharya, Debabrata Mukhopadhyay, Rajiv Kumar: Sclerostin binds and regulates the activity of cysteine-rich protein 61. Biochem Biophys Res Commun 392, 36-40 (2009)
doi:10.1016/j.bbrc.2009.12.143
PMid:20043874 PMCid:2821021
133. David G. Winkler, Changpu Yu, James C. Geoghegan, Ethan W. Ojala, John E. Skonier, Diana Shpektor, May K. Sutherland, John A. Latham; Noggin and sclerostin bone morphogenetic protein antagonists form a mutually inhibitory complex. J Biol Chem 279, 36293-36298 (2004)
doi:10.1074/jbc.M400521200
PMid:15199066
134. Harold P. Erickson HP, J. L. Inglesias: A six-armed oligomer isolated from cell surface fibronectin preparations. Nature 311, 267-269 (1984)
doi:10.1038/311267a0
PMid:6482952
135. Maurizio Pacifici: Tenascin-C and the development of articular cartilage. Matrix Biol 14, 689-698 (1995)
doi:10.1016/S0945-053X(05)80011-3
136. Brian K. Hall, Tsutomo Miyake: All for one and one for all: condensations and the initiation of skeletal development. Bioessays 22, 138-147, (2000)
doi:10.1002/(SICI)1521-1878(200002)22:2<138::AID-BIES5>3.0.CO;2-4
137. Erick Forsberg, Emilio Hirsch, Leopold Fröhlich, Michael Meyer, Peter Ekblom, Attila Aszodi, Sabine Werner, Reinhard Fässler: Skin wounds and severed nerves heal normally in mice lacking tenascin-C. Proc Natl Acad Sci U S A 93, 6594-6599 (1996)
doi:10.1073/pnas.93.13.6594
138. Yumiko Saga, Takeshi Yagi, Yoji Ikawa, Teruyo Sakakura, Shinichi Aizawa: Mice develop normally without tenascin. Genes Dev 6, 1821-1831 (1992)
doi:10.1101/gad.6.10.1821
139. Peter S. Rowe, Claudine L. Oudet, Fiona Francis, Christiane Sinding, Solange Pannetier, Mike J. Econs, Tim M. Strom, Thomas Meitinger, Michele Garabedian, Albert David, Marie-Alice Macher, Elisabeth Questiaux, Ewa Popowska, Ewa Pronicka, Andrew P. Read, Agnes Mokrzycki, Francis H. Glorieux, Marc K. Drezner, Andre Hanauer, Hans Lehrach, Johnathan N. Goulding, Jeffrey L.H. O'Riordan: Distribution of mutations in the PEX gene in families with X-linked hypophosphataemic rickets (HYP) Hum Mol Genet 6, 539-549 (1997)
doi:10.1093/hmg/6.4.539
PMid:9097956
140. Tim M. Strom, Harald Jüppner: PHEX, FGF23, DMP1 and beyond. Curr Opin Nephrol Hypertens 17, 357-362 (2008)
doi:10.1097/MNH.0b013e3282fd6e5b
PMid:18660670
141. Pawel R. Kiela, Fayez K. Ghishan: Recent advances in the renal-skeletal-gut axis that controls phosphate homeostasis. Lab Invest 89:7-14 (2009)
doi:10.1038/labinvest.2008.114
PMid:19029978
142. Andrea F. Ruchon, Harriet S. Tenenhouse, Mieczyslaw Marcinkiewicz, Geraldine Siegfried, Jane E. Aubin, Luc DesGroseillers, Philippe Crine, Guy Boileau: Developmental expression and tissue distribution of Phex protein: effect of the Hyp mutation and relationship to bone markers. J Bone Miner Res 15, 1440-1450 (2000)
doi:10.1359/jbmr.2000.15.8.1440
PMid:10934642
143. Shiguang Liu, Wen Tang, Jianping Zhou, Luke Vierthaler, L. Darryl Quarles: Distinct roles for intrinsic osteocyte abnormalities and systemic factors in regulation of FGF23 and bone mineralization in Hyp mice. Am J Physiol Endocrinol Metab 293, E1636-1644 (2007)
doi:10.1152/ajpendo.00396.2007
PMid:17848631
144. Xiuying Bai, Dengshun Miao, Dibiyendu Panda, Scott Grady, Marc D. McKee, David Goltzman, Andrew C. Karaplis: Partial rescue of the Hyp phenotype by osteoblast-targeted PHEX (phosphate-regulating gene with homologies to endopeptidases on the X chromosome) expression. Mol Endocrinol 16, 2913-2925 (2002)
doi:10.1210/me.2002-0113
PMid:12456809
145. Brigitte Ecarot, Francis H. Glorieux, Marguerite Desbarats, Rose Travers, L. Labelle: 1992. Effect of dietary phosphate deprivation and supplementation of recipient mice on bone formation by transplanted cells from normal and X-linked hypophosphatemic mice. J Bone Miner Res 7, 523-530 (1992)
doi:10.1002/jbmr.5650070508
PMid:1319665
146. Reinhold Erben, Dagmar Mayer, Karin Weber, Kenneth Jonsson, Harald Jüppner, Beate Lanske: Overexpression of human PHEX under the human beta-actin promoter does not fully rescue the Hyp mouse phenotype. J Bone Miner Res 20, 1149-1160 (2005)
doi:10.1359/JBMR.050212
PMid:15940367
147. Shiguang Liu, Peter S. Rowe, Luke Vierthaler, Jianping Zhou, L. Darryl Quarles: Phosphorylated acidic serine-aspartate-rich MEPE-associated motif peptide from matrix extracellular phosphoglycoprotein inhibits phosphate regulating gene with homologies to endopeptidases on the X-chromosome enzyme activity. J Endocrinol 192, 261-267 (2007)
doi:10.1677/joe.1.07059
PMid:17210763
148. William N. Addison, Yukiko Nakano, Thomas Loisel, Phillippe Crine, Marc D. McKee: MEPE-ASARM peptides control extracellular matrix mineralization by binding to hydroxyapatite: an inhibition regulated by PHEX cleavage of ASARM. J Bone Miner Res 23, 1638-1649 (2008)
doi:10.1359/jbmr.080601
PMid:18597632
149. Aline Martin, Valentin David, Jennifer S. Laurence, Patricia M. Schwarz, Eileen M. Lafer, Anne-Marie Hedge, Peter S. Rowe: Degradation of MEPE, DMP1, and release of SIBLING ASARM-peptides (minhibins): ASARM-peptide(s) are directly responsible for defective mineralization in HYP. Endocrinology 149, 1757-1772 (2008)
doi:10.1210/en.2007-1205
PMid:18162525 PMCid:2276704
150. Peter S. Rowe, Naoko Matsumoto, Osk D. Jo, Remi N. Shih, Jeannine Oconnor, Martine P. Roudier, Steve Bain, Shiguang Liu, Jody Harrison, Norimoto Yanagawa: Correction of the mineralization defect in hyp mice treated with protease inhibitors CA074 and pepstatin. Bone 39, 773-786 (2006)
PMid:18037620
151. Hamish Dobbie, Robert J. Unwin, Nuno J.R. Faria, David G. Shirley: Matrix extracellular phosphoglycoprotein causes phosphaturia in rats by inhibiting tubular phosphate reabsorption. Nephrol Dial Transplant 23, 730-733 (2008)
doi:10.1093/ndt/gfm535
PMid:19005008 PMCid:2588094
152. Joanne Marks, Linda J. Churchill, Edward S. Debnam, Robert J. Unwin: Matrix extracellular phosphoglycoprotein inhibits phosphate transport. J Am Soc Nephrol 19, 2313-2320 (2008)
doi:10.1681/ASN.2008030315
PMid:15843468 PMCid:1484502
153. Shiguang Liu, Thomas A. Brown, Jianping Zhou, Zhou-Sheng Xiao, Hani Awad, Farshid Guilak, L. Darryl Quarles: Role of matrix extracellular phosphoglycoprotein in the pathogenesis of X-linked hypophosphatemia. J Am Soc Nephrol 16, 1645-1653 (2005)
doi:10.1681/ASN.2004121060
PMid:19520780 PMCid:2819738
154. Valentin David, Aline Martin, Anne-Marie Hedge, Peter S. Rowe: Matrix extracellular phosphoglycoprotein (MEPE) is a new bone renal hormone and vascularization modulator. Endocrinology 150, 4012-4023 (2009)
doi:10.1210/en.2009-0216
PMid:15590969
155. Doron Bresler, Jan Bruder, Klaus Mohnike, William D. Fraser, Peter S.N. Rowe: Serum MEPE-ASARM-peptides are elevated in X-linked rickets (HYP): implications for phosphaturia and rickets. J Endocrinol 183, R1-9 (2004)
doi:10.1677/joe.1.05989
PMid:12486138
156. Simonetta Bernocco, Barry M. Steiglitz, Dmitri I. Svergun, Maxim V. Petoukhov, Florence Ruggiero, Sylvie Ricard-Blum, Christine Ebel, Christophe Geourjon, Gilbert Deleage, Bernard Font, Denise Eichenberger, Daniel S. Greenspan, David J.S. Hulmes: Low resolution structure determination shows procollagen C-proteinase enhancer to be an elongated multidomain glycoprotein. J Biol Chem 278, 7199-7205 (2002)
doi:10.1074/jbc.M210857200
157. David J.S. Hulmes, A. Paul Mould, Efrat Kessler: The CUB domains of procollagen C-proteinase enhancer control collagen assembly solely by their effect on procollagen C-proteinase/bone morphogenetic protein-1. Matrix Biol 16, 41-45 (1997)
doi:10.1016/S0945-053X(97)90115-3
PMid:15834133
158. Catherine Moali, Bernard Font, Florence Ruggiero, Denise Eichenberger, Patricia Rousselle, Vincent François, Ake Oldberg, Leena Bruckner-Tuderman, David J.S. Hulmes: Substrate-specific modulation of a multisubstrate proteinase. C-terminal processing of fibrillar procollagens is the only BMP-1-dependent activity to be enhanced by PCPE-1. J Biol Chem 280, 24188-24194 (2005)
doi:10.1074/jbc.M501486200
PMid:20207734 PMCid:2871463
159. Mourad Bekhouche, Daniel Kronenberg, Sandrine Vadon-Le Goff, Cecile Bijakowski, Ngee H. Lim, Bernard Font, Efrat Kessler, Alain Colige, Hideaki Nagase, Gillian Murphy, David J.S. Hulmes, Catherine Moali: Role of the netrin-like domain of procollagen C-proteinase enhancer-1 in the control of metalloproteinase activity. J Biol Chem 285, 15950-15959 (2010)
doi:10.1074/jbc.M109.086447
PMid:16354695 PMCid:1317636
160. Barry M. Steiglitz, Jaclynn M. Kreider, Elizabeth P. Frankenburg, William N. Pappano, Guy G. Hoffman, Jeffrey A. Meganck, Xiaowen Liang, Magnus Höök, David E. Birk, Steven A. Goldstein, Daniel S. Greenspan: Procollagen C proteinase enhancer 1 genes are important determinants of the mechanical properties and geometry of bone and the ultrastructure of connective tissues. Mol Cell Biol 26, 238-49 (2006)
doi:10.1128/MCB.26.1.238-249.2006
PMid:20049897
161. Yukiko Nakano, Jennifer Forsprecher, Mari T. Kaartinen: Regulation of ATPase activity of transglutaminase 2 by MT1-MMP: implications for mineralization of MC3T3-E1 osteoblast cultures. J Cell Physiol 223, 260-269 (2010)
PMid:11113189 PMCid:88788
162. Vincenzo De Laurenzi, Gerry Melino: Gene disruption of tissue transglutaminase. Mol Cell Biol 21, 148-155 (2001)
doi:10.1128/MCB.21.1.148-155.2001
PMid:11274171
163. Nisha Nanda, Siiri E. Iismaa, W. Andrew Owens, Ahsan Husain, Fabienne Mackay, Robert M. Graham: Targeted inactivation of Gh/tissue transglutaminase II. J Biol Chem 276, 20673-20678 (2001)
doi:10.1074/jbc.M010846200
PMid:17341477
164. Yukiko Nakano, Hadil F. Al-Jallad, Aisha Mousa, Mari T. Kaartinen: Expression and localization of plasma transglutaminase factor XIIIA in bone. J Histochem Cytochem 55, 675-685 (2007)
doi:10.1369/jhc.6A7091.2007
PMid:16469487
165. Hadil F. Al-Jallad, Yukiko Nakano, Jeff L.Y. Chen, Erin McMillan, Celine Lefebvre, Mari T. Kaartinen: Transglutaminase activity regulates osteoblast differentiation and matrix mineralization in MC3T3-E1 osteoblast cultures. Matrix Biol 25, 135-148 (2006)
doi:10.1016/j.matbio.2005.11.001
166. Esben S. Sørensen, Torben E. Petersen: Phosphorylation, glycosylation, and transglutaminase sites in bovine osteopontin. Ann N Y Acad Sci 760, 363-366 (1995)
doi:10.1111/j.1749-6632.1995.tb44658.x
PMid:9278432
167. Mari T. Kaartinen, Arja Pirhonen, Annikka Linnala-Kankkunen, Pekka H. Mäenpää: Transglutaminase-catalyzed cross-linking of osteopontin is inhibited by osteocalcin. J Biol Chem 272, 22736-22741 (1997)
doi:10.1074/jbc.272.36.22736
PMid:9880554
168. Mari T. Kaartinen, Arja Pirhonen, Annikka Linnala-Kankkunen, Pekka Mäenpää: Cross-linking of osteopontin by tissue transglutaminase increases its collagen binding properties. J Biol Chem 274, 1729-1735 (1999)
doi:10.1074/jbc.274.3.1729
169. Maria Nurminskaya, Cordula Magee, Lidia Faverman, Thomas F. Linsenmayer: Chondrocyte-derived transglutaminase promotes maturation of preosteoblasts in periosteal bone. Dev Biol 263, 139-152 (2003)
doi:10.1016/S0012-1606(03)00445-7
PMid:11092396
170. Filanti C, Dickson GR, Di Martino D, Ulivi V, Sanguineti C, Romano P, Palermo C, Manduca P: The expression of metalloproteinase-2, -9, and -14 and of tissue inhibitors-1 and -2 is developmentally modulated during osteogenesis in vitro, the mature osteoblastic phenotype expressing metalloproteinase-14. J Bone Miner Res 15, 2154-2168 (2000)
doi:10.1359/jbmr.2000.15.11.2154
PMid:9500469
171. Takeshi Itoh, Masatoshi Tanioka, Hiroshi Yoshida, Takayuki Yoshioka, Hirofumi Nishimoto, Shigeyoshi Itohara: Reduced angiogenesis and tumor progression in gelatinase A-deficient mice. Cancer Res 58, 1048-1051 (1998)
PMid:10841523 PMCid:300851
172. Robert Pyo, Jason K. Lee, J. Michael Shipley, John A. Curci, Dongli Mao, Scott J. Ziporin, Terri L. Ennis, Steven D. Shapiro, Robert M. Senior, Robert W. Thompson: Targeted gene disruption of matrix metalloproteinase-9 (gelatinase B) suppresses development of experimental abdominal aortic aneurysms. J Clin Invest 105, 1641-1649 (2000)
doi:10.1172/JCI8931
PMid:11986329
173. Anke Rattenholl, William N. Pappano, Manuel Koch, Douglas R. Keene, Karl E. Kadler, Takako Sasaki, Rupert Timpl, Robert E. Burgeson, Daniel S. Greenspan, Leena Bruckner-Tuderman: Proteinases of the bone morphogenetic protein-1 family convert procollagen VII to mature anchoring fibril collagen. J Biol Chem 277, 26372-26378 (2002)
doi:10.1074/jbc.M203247200
PMid:15599395 PMCid:535063
174. Masako Miura, Xiao-Dong Chen, Matthew R. Allen, Yanming Bi, Stan Gronthos, Byoung-Moo Seo, Saquib Lakhani, Richard A. Flavell, Xin-Hua Feng, Pamela G. Robey, Marian M. Young, Songtao Shi: A crucial role of caspase-3 in osteogenic differentiation of bone marrow stromal stem cells. J Clin Invest 114, 1704-1713 (2004)
PMid:16762607
175. Kenn Holmbeck, Paolo Bianco, John Caterina, Susan Yamada, Mark Kromer, Sergei A. Kuznetsov, Mahesh Mankani, Pamela G. Robey, A. Robin Poole, Isabelle Pidoux, Jerrold M. Ward, Henning Birkedal-Hansen: MT1-MMP-deficient mice develop dwarfism, osteopenia, arthritis, and connective tissue disease due to inadequate collagen turnover. Cell 99, 81-92 (1999)
PMid:15137053
176. Kenn Holmbeck, Paolo Bianco, Susan Yamada, Henning Birkedal-Hansen: MT1-MMP: a tethered collagenase. J Cell Physiol 200, 11-9 (2004)
doi:10.1002/jcp.20065
PMid:15601659
177. Kenn Holmbeck, Paolo Bianco, Isabelle Pidoux, S. Inoue, R. Clark Billinghurst, William Wu, Kali Chrysovergis, Susan Yamada, Henning Birkedal-Hansen, A. Robin Poole: The metalloproteinase MT1-MMP is required for normal development and maintenance of osteocyte processes in bone. J Cell Sci 118, 147-156 (2005)
doi:10.1242/jcs.01581
178. Nabil G. Seidah NG, Mayer G, Zaid A, Rousselet E, Nassoury N, Poirier S, Essalmani R, Prat A: The activation and physiological functions of the proprotein convertases. Int J Biochem Cell Biol 40, 1111-1125 (2008)
doi:10.1016/j.biocel.2008.01.030
PMid:7629113
179. Xiaodong Wang, Jih-tung Pai, Elizabeth A. Wiedenfeld, Julio C. Medina, Clive A. Slaughter, Joseph L. Goldstein, Michael S. Brown: Purification of an interleukin-1 beta converting enzyme-related cysteine protease that cleaves sterol regulatory element-binding proteins between the leucine zipper and transmembrane domains. J Biol Chem 270, 18044-18050 (1995)
doi:10.1074/jbc.270.30.18044
PMid:9092581
180. Guimin Guan, Pei-Hua Dai, Timothy F. Osborne, Jae B. Kim, Ishaiahu Shechter: Multiple sequence elements are involved in the transcriptional regulation of the human squalene synthase gene. J Biol Chem 272, 10295-102302 (1997)
doi:10.1074/jbc.272.15.10295
PMid:18038217
181. Schröder M: Endoplasmic reticulum stress responses. Cell Mol Life Sci 65, 862-894 (2008)
doi:10.1007/s00018-007-7383-5
PMid:16417584
182. Tomohiko Murakami, Shinichi Kondo, Maiko Ogata, Soshi Kanemoto, Atsushi Saito, Atsushi Wanaka, Kazunori Imaizumi: Cleavage of the membrane-bound transcription factor OASIS in response to endoplasmic reticulum stress. J Neurochem 96, 1090-1100 (2006)
doi:10.1111/j.1471-4159.2005.03596.x
PMid:19767743
183. Tomohiko Murakami, Atsushi Saito, Shin-ichiro Hino, Shinichi Kondo, Soshi Kanemoto, Kazuyasu Chihara, Hiroshi Sekiya, Kenji Tsumagari, Kimiko Ochiai, Kazuya Yoshinaga, Masahiro Saitoh, Riko Nishimura, Toshiyuki Yoneda, Ikuyo Kou, Tatsuya Furuichi, Shiro Ikegawa, Masahito Ikawa, Masaru Okabe, Akio Wanaka, Kazunori Imaizumi: Signalling mediated by the endoplasmic reticulum stress transducer OASIS is involved in bone formation. Nature Cell Biol 11, 1205-1211 (2009)
doi:10.1038/ncb1963
PMid:14612568 PMCid:283539
184. Taranpreet K. Chandhoke, Yu-Feng Huang, Fei Liu, Gloria A. Gronowicz, Douglas J. Adams, John R. Harrison, Barbara E. Kream: Osteopenia in transgenic mice with osteoblast-targeted expression of the inducible cAMP early repressor. Bone 43, 101-109 (2008)
PMid:18025304 PMCid:2080931
185. Kornelia Schlombs, Thomas Wagner, Jochen Scheel: Site-1 protease is required for cartilage development in zebrafish. Proc Natl Acad Sci U S A 100, 14024-14029 (2003)
doi:10.1073/pnas.2331794100
PMid:11717426 PMCid:61088
186. Debabrata Patra, Xiaoyun Xing, Sherri Davies, Jennifer Bryan, Carl Franz, Ernst B. Hunziker, Linda J. Sandell: Site-1 protease is essential for endochondral bone formation in mice. J Cell Biol 179, 687-700 (2007)
doi:10.1083/jcb.200708092
PMid:10520996
187. Jian Yang, Joseph L. Goldstein, Robert E. Hammer, Young-Ah Moon, Michael S. Brown, Jay D. Horton: Decreased lipid synthesis in livers of mice with disrupted Site-1 protease gene. Proc Natl Acad Sci U S A 98, 13607-13612 (2010)
doi:10.1073/pnas.201524598
PMid:18460422 PMCid:2474743
188. Jeff P. Gorski, Nichole T. Huffman, Sridar Chittur, Ronald J. Midura, Claudine Black, Julia Oxford, Nabil G. Seidah: Inhibition of proprotein convertase SKI-1 blocks transcription of key extracellular matrix genes regulating osteoblastic mineralization. J Biol Chem 286, (2011) (Epub ahead of print)
Abbreviations: BMF, biomineralization foci; BSP, bone sialoprotein; AEBSF, 4-(2-aminoethyl) benzenesulfonyl fluoride hydrochloride; SKI-1, site-1, MBTPS1, or subtilisin/kexin isoenzyme-1; PCOLCE1, procollagen C-terminal propeptidase enhancer1; 1,25-vit. D3-MARRS protein, membrane associated, rapid response steroid binding receptor; BMP, bone morphogenetic protein; TGase, transglutaminase; ADHR, X-linked hypophosphatemia, autosomal dominant hypophosphatemic rickets; XLH, X-linked hypophosphatemia; ARHP, autosomal recessive hypophosphatemia; HHRH, hereditary hypophosphatemic rickets with hypercalciuria; ENPP1, PC-1, ectonucleotide pyrophosphatase/phosphodiesterase; Fetuin, alpha2HS-glycoprotein; TNAP, tissue nonspecific alkaline phosphatase; DMP1, dentin matrix protein 1; OPN, osteopontin; NTD, N-terminal domain; GLA, gamma-carboxyglutamic acid; SIBLING, small integrin-binding ligand, N-linked glycoprotein; BGP, beta-glycerolphosphate; MMP, matrix metalloproteinase; BAG-75, bone acidic glycoprotein-75; PC, proprotein convertase; Osx, osterix; BSA, bovine serum albumin; FBS, fetal bovine serum.
Key Words: Biomineralization, PHEX, Phospho 1, Bone sialoprotein, DMP1, Type XI collagen, Fetuin
Send correspondence to: Jeff Gorski, Department of Oral Biology, School of Dentistry, University of Missouri-Kansas City, 650 East 25th Street, Kansas City, MO 64108, Tel: 816-235-2537, Fax: 816-235-5524, E-mail: gorskij@umkc.edu